DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG10559

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster


Alignment Length:411 Identity:146/411 - (35%)
Similarity:244/411 - (59%) Gaps:13/411 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VPKWLNQTQFEELLAADV-DQFSKIVGFRVKPAMAPGENYATLMLRISIDVELTDKSTKLVSFMM 109
            :|.||....|||||:... ..::.|..|:.:..:.|||||:|:|||:.::|||.|.:.:.||:|:
  Fly    10 MPTWLRANLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRLKLEVELQDHTIENVSYML 74

  Fly   110 KVPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAFKLDATKEPKVANTV 174
            |.|:|.....:::...|.|..|...:.:::|::|::||..|:::||..:|:::||..:     .|
  Fly    75 KTPYDFEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKAYEIDAPDD-----YV 134

  Fly   175 LMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDIFVNGVMGNN-KEAI 238
            |:.|||..||:|::|||.|::..||..|.::||:||..||.:.:.||||..::.....:. ||:|
  Fly   135 LLQDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQNYLQPTYADTMKESI 199

  Fly   239 IAFMEGMLASFRTSFMANLDKFKNGEEYREKLEKALAGLTMEFMKLGIVDPNEFNALNHGDCWMN 303
                |.:..:....|:..|..::..|||...:.|....:......:...||.:||||||||||.:
  Fly   200 ----EQVAETLGKYFLKCLPLYEGYEEYSAAVHKMQPKIVDLMYAMNTPDPQDFNALNHGDCWTS 260

  Fly   304 NLLFKM-NSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFDFFIRHYQEALVKHL 367
            |::||. :.|.:..:..|||.|.||..|.|.||:||::.|.:.:.:||.||:||::|.:.||:||
  Fly   261 NIMFKYEDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDHLVEHL 325

  Fly   368 GILGFTGRK-PSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSATFDNFMSDSADGVSFRGSL 431
            .:|.:...| |:|..||..|:|||.........:.|.||||.|:.|...:|::::.:|...:.::
  Fly   326 RMLNYPEAKTPTLGFLHTQLLKYGRVGYHIAFILCPPVLLDRTEDANLTDFVTETDNGDGLKLAM 390

  Fly   432 YANKRCQEYIERILPWLDNRG 452
            |:|.|.::::..||.||:|||
  Fly   391 YSNARYKKHVSAILKWLNNRG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 108/293 (37%)
EcKinase 516..800 CDD:281023
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 108/293 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442529
Domainoid 1 1.000 57 1.000 Domainoid score I17979
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101022at50557
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.