DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG31370

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:419 Identity:100/419 - (23%)
Similarity:183/419 - (43%) Gaps:59/419 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 DQ--IPDWLNIDDFKEIILS--AEPNFEKILSSTSKLATKP----GDNFASKLLKVEIEAQLKDN 536
            ||  :|:|||.....:::.|  .||:..     .:||...|    |||:||.:::..:| .:...
  Fly     8 DQLNVPEWLNEQFVTDVLRSHEKEPDLR-----VTKLDFTPGSAKGDNYASVIIRARVE-YITQK 66

  Fly   537 SVKTFSYILKVHSDNDAINFSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVS 601
            ...:.|.|:|...:    .|:...||..||.:|...:|.|.|..::              :.|.|
  Fly    67 GFFSKSLIIKTVLE----MFAGSALFKTEIGMYRKVLPEFARILRE--------------NNDTS 113

  Fly   602 KEY--LLLENLQPSGFKMVDRMIGMD--------LEHSK-C-TLKKLAQWHAASLKYKELNGPYS 654
            :.|  .:..:|:||...:.:.:..||        |.|.: | ...|||::||.|:|.......:.
  Fly   114 RLYAECIYYSLEPSQVMIFEDLGEMDYAMVRDRVLTHGEICGAYSKLAKFHALSMKIINERPEFV 178

  Fly   655 PKYNNGIFTEQTAPIFKGMFVNTKKSFIEEVSKFDGVDEYLHKMPEILDTYVDR---ILEDAKIN 716
            .::.:||.......:..||  ...|.|:..:.:.|....:..|: |:  .::||   |:::.:.|
  Fly   179 KEFKDGICLVDIPYMSSGM--GPFKDFLGRIPELDRYKTHFEKI-EV--HFIDRLRDIMKEYQTN 238

  Fly   717 EQ-AFNVLNHGDAWINNIMFQYESD-GRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQ 779
            .| .:.||.|||....|||.::..: |..::.:|||:|.......|.||.|.|......:.::.:
  Fly   239 PQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGE 303

  Fly   780 FDYLIRWYHQNMKEHAKLLNYNGFIPS----LKELHAILIQHPIFAAGTVLTTLSMCLNKTTDDF 840
            .:.|:.:|...::|..:.:.|.|.:|.    .||::.:.....:|.:..:..::.:.|...|::.
  Fly   304 LETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSVGLSLETATNEE 368

  Fly   841 TTDSFLGNEENGKSLREAMFSNERYRANI 869
            |.|......|..||:. |.|....|..|:
  Fly   369 TDDKLQDFIEECKSIL-ARFERSGYFENL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 72/304 (24%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 71/300 (24%)
APH <202..320 CDD:279908 30/120 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.