DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG31098

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_733091.1 Gene:CG31098 / 43057 FlyBaseID:FBgn0051098 Length:417 Species:Drosophila melanogaster


Alignment Length:432 Identity:113/432 - (26%)
Similarity:196/432 - (45%) Gaps:53/432 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 QIPDWLNIDDFKEIILSAEPNFEKILSSTSKLATKP---GD---NFASKLLKVEIEAQLKDNSVK 539
            |.|:||..:..::::   :.:|::...:.::|..|.   ||   .|||::.:.....|.......
  Fly     9 QAPEWLTAEFLQDVL---KEHFKEEQLAVTELIVKSAQVGDQAAGFASEMHRASFNLQRGTAPKG 70

  Fly   540 TFSYILKVH--SDNDAINFSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVSK 602
            .||.|:|.|  ....|:.... .||.:||..|...:|..:...:.:|.....:|..: .:.:..:
  Fly    71 KFSVIVKDHPKGQTGAVAHRS-KLFKREILAYKEVLPRIQALLQSIGDQTKIAPTCY-YTTESPE 133

  Fly   603 EYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIFTEQTA 667
            .:|:||::|.|||:..:|...::|::...|::|:|:.||.|    .|....||:... .|.|  |
  Fly   134 PFLILEDMQLSGFENFERGRLLNLDYVLPTIEKVAKLHACS----ALIAQDSPEVLE-FFDE--A 191

  Fly   668 PI--------FKGMFVNTKKSFIEEVSKFDGVDEYLHKMPEILDTYVDRILEDAKINEQAFNVLN 724
            ||        |...|....:...|||:.:.|.:|...||..:.:..:.|.|...:...:.|.|.|
  Fly   192 PISRNPDRRDFLTFFPVNIRCVAEEVAHWKGYEEITEKMFNLAENVLQRALTMFESTGKDFRVFN 256

  Fly   725 HGDAWINNIMFQYESDGRVKETLL-LDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYH 788
            ..|.||||::|...::.:..:.:: ||.|:...|:|..||.||:..|...:::...:.|::|.|.
  Fly   257 LTDLWINNLLFHINNETKEPDDVVTLDFQLAYVGSPTIDLNYFLYGSLNENVRKVHYKYIVREYQ 321

  Fly   789 QNMKEHAKLLNYNGFIPSLKELHAILIQHPIFA--AGTVLTTLSM----------CLNKTTDDFT 841
            :.:::..:.|||.|.||:|||:|..||:..:..  ..|.||.|..          .||..|    
  Fly   322 RVLQQTLEKLNYQGHIPTLKEIHIELIKTSLMGVIGATCLTPLIFREGAGFENLEDLNSRT---- 382

  Fly   842 TDSFLGNEENGKSLREAMFSNERYRANIERVMPWINRRGLLD 883
                    |:|...|.....|.:|||.::|.:......|.||
  Fly   383 --------ESGDRFRRENVENPKYRAFLQRTIKEFELSGFLD 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 77/300 (26%)
CG31098NP_733091.1 EcKinase 50..333 CDD:281023 75/291 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.