DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG31104

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:407 Identity:104/407 - (25%)
Similarity:178/407 - (43%) Gaps:55/407 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 NTD--QIPDWLNIDDFKEIILSAE--PNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSV 538
            |.|  |.|.|||.....:|:...|  |:. |:.......||..||::||.:.:.::|......  
  Fly     9 NADELQAPAWLNAQFIGDILREYEQLPDL-KVTDLQVSPATAQGDHYASVMFRTKVEYTTPKG-- 70

  Fly   539 KTFS-YILKVHSDNDAIN---FSDFNLFPKEIEVYSTYVPAFERFYKDVG-LPVTFSPKSFRLSK 598
            |.|. .|:|...:.:...   .|:.:||..||.:|...:|.|||..::.| ....|.|..:...|
  Fly    71 KFFKPLIIKTMPEQEGHKKDMLSESHLFETEIGMYCHALPEFERILREAGDNTKLFVPCIYHSLK 135

  Fly   599 DVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIF- 662
              .::.::.|:|.|.|:.:: |.....|...|....|||:|||.|:|.......:..::..|:| 
  Fly   136 --PRQVMIFEDLVPQGYTVI-RDSPPSLGDLKLAFDKLAKWHAVSMKVINEQPYFLKEFQYGLFE 197

  Fly   663 --TEQTAPIFKGMFVNT-KKSFIEEVSKFDGVDEYLHKMPEILDTYVDRILEDAKINE------- 717
              |..|.|     |:.| ..:|||.:.|...:.:|.|...:|.|.|:.|:  :.:::|       
  Fly   198 MPTIDTDP-----FITTGMTNFIEMLDKMPELRKYKHHFEKIKDNYMQRL--EVEMHEYHKYRRN 255

  Fly   718 QAFNVLNHGDAWINNIMFQYESD-GRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFD 781
            ..:.||.|||..:.|:||::..: |...:.:|:|.|::.......||.|.:....:.:.:.:..:
  Fly   256 DRYYVLCHGDFHLRNMMFRHNKELGAYDDVMLVDFQLSNLCPITVDLTYSVYMLMEPEQRWEMGE 320

  Fly   782 YLIRWYHQNMKEHAKLLNYNGFIPSLKELHAILIQHPIFAAGTVLTTLSMCLNKTTDDFTTDSFL 846
            .||..|...:....:.:.|.|.:|:.:||.. .||:                ||..|.|...:||
  Fly   321 NLINEYFSVLVATLRKIGYKGDMPTQRELWE-QIQN----------------NKYYDFFLISTFL 368

  Fly   847 ----GNEENGKSLREAM 859
                |.:.|...:.||:
  Fly   369 PIMVGVKSNDLKMHEAL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 74/300 (25%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 74/300 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459818
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.