DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG11892

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_651372.1 Gene:CG11892 / 43053 FlyBaseID:FBgn0039313 Length:439 Species:Drosophila melanogaster


Alignment Length:450 Identity:117/450 - (26%)
Similarity:217/450 - (48%) Gaps:48/450 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 ELLAALK-------PQQPQPENTD---QIPDWLN---IDD-----FKEIILSAEPNFEKILSSTS 510
            :|:.||.       |:...||.|.   ..|:||.   :.|     :|:.::..  |:.|:..:..
  Fly     5 DLIGALDAIPKLTVPESLVPEETSVFLDAPEWLTESYLQDALRKYYKDQLIRI--NWVKVNPALG 67

  Fly   511 KLATKPGDNFASKLLKVEIEAQLKDNSVKTFSYILKVHSDNDAINFSD-----FNLFPKEIEVYS 570
            |     |:|:...|.:|:.:....|.|.:...||:|  |..:...|:.     :::|.:|:.:|.
  Fly    68 K-----GENYGGVLTRVKAQFTRSDGSSQLGHYIVK--STFEGNEFAQNAMKPYDIFNREMIIYE 125

  Fly   571 TYVPAFERFYKDVGLPVTFSPKSFRLSKDVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKK 635
            ..:|..:...:::|.......::  ::.|:....|:.|:|...||.|.||::|:|.:.::..|:|
  Fly   126 QVLPKQKALLREIGDAEQIFAET--MAVDIDNSALIFEDLNARGFVMPDRLVGLDQKLARIVLRK 188

  Fly   636 LAQWHAASLKYKELNGPYSPKYNNGIF---TEQTAPIFKGMFVNTKKSFIEEVSKFDGVDEYLHK 697
            ||:.||.|....|........|:.|.|   |:...|.|.||.    ::....|:::.|.::|..|
  Fly   189 LAKMHATSAVLNERENHILESYDRGFFNRYTDNYEPAFVGML----QAATRRVAQWPGYEKYAEK 249

  Fly   698 MPEILDTYVD---RILEDAKINEQAFNVLNHGDAWINNIMFQYESD-GRVKETLLLDHQVTKYGN 758
            :..::..|::   ||.:   |:....|||.|||.|.||::.:|:.. |...:.:::|.|.|.:|:
  Fly   250 LKALVPIYMELGKRIFD---ISPGHINVLAHGDLWTNNVLVKYDKQTGEPIDVVIIDFQYTAWGS 311

  Fly   759 PAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLNYNGFIPSLKELHAILIQHPIFAAG 823
            ||.||:||:.||.:.|:..:..:.||.:|.::..:..|.|.|...||||.:.|..|.|...:||.
  Fly   312 PALDLFYFMNSSLEFDLHQNHQEQLIAYYFRHFADTLKKLQYRSTIPSLHQFHQQLQQKKFYAAH 376

  Fly   824 TVLTTLSMCLNKTTDDFTTDSFLGNEENGKSLREAMFSNERYRANIERVMPWINRRGLLD 883
            |.::...:..|..|.|...::.:.|.:...:.::|.:.|...:..:..::|.....||||
  Fly   377 TSISVFPVQRNVETADADFNALMENNQRAMNFKDACYRNPIAQRILRELLPDFEAEGLLD 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 80/295 (27%)
CG11892NP_651372.1 EcKinase 68..353 CDD:281023 81/300 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459420
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.