DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG10513

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster


Alignment Length:426 Identity:130/426 - (30%)
Similarity:214/426 - (50%) Gaps:47/426 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 PDWLNIDDFKEII--LSAEPNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKD--NSVKTFSY 543
            |:||:....:.::  |..:|.. :|.....|.||..|||:||.:.:|.| ..||.  .|.:|..|
  Fly    16 PEWLDETYLERLLRDLKNDPGL-RITDLVIKPATAKGDNYASVMTRVRI-LFLKSGAKSPETEYY 78

  Fly   544 ILKVHSDNDAIN---FSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVSKEYL 605
            |:|...:|||..   ||.:.:...|:.:|...:|......:....|.....|:  |..|...|.:
  Fly    79 IVKTTYENDAFASGIFSQYQVSTTEMRMYEKILPQLSSLIEKTRQPEKVFAKT--LHVDYEHEAI 141

  Fly   606 LLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIFTEQTAPIF 670
            :.|:|..:.:.:.||::|.||||::..|:|||:.|||:....|.......|:::|||...| ..|
  Fly   142 IFEDLAVTKYVLADRLVGFDLEHTRLGLRKLAKMHAAAAVLNERQPGLLTKFDHGIFNRHT-QAF 205

  Fly   671 KGMFVNTKKSFIEEVSKFDGV-DEYLHKMPEILDTYVDRILEDAKINEQA--------------F 720
            ...||||.           || .::..:.||:.:.|..::   .|:.|:.              |
  Fly   206 APFFVNTV-----------GVAADFARECPELGERYATKL---KKLQERVMEYSTRVYDPQPGDF 256

  Fly   721 NVLNHGDAWINNIMFQYESDGRVKETL---LLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDY 782
            |.|.|||.|:||:|.:|   |..||.|   |:|.|...:.:||.||:||..:|.|:||:.:|.|.
  Fly   257 NTLVHGDYWVNNVMLRY---GENKEPLDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQDA 318

  Fly   783 LIRWYHQNMKEHAKLLNYNGFIPSLKELHAILIQHPIFAAGTVLTTLSMCLNKTTDDFTTDSFLG 847
            |.::||..:.|..|.||:.|:||:|::....|.:...||....|...::..|....|...::.:.
  Fly   319 LFQYYHTVLVETLKDLNFGGYIPTLRQFVLQLERGRFFAVTVALVCQAILTNDQNADADFNALMK 383

  Fly   848 NEENGKSLREAMFSNERYRANIERVMPWINRRGLLD 883
            ::|.|::.|:.:::|:|.:.|::|.:|..:|.||||
  Fly   384 DDERGRNFRKVLYTNKRLQDNLKRELPRFDRSGLLD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 97/306 (32%)
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 97/306 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459468
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.