DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG14314

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:407 Identity:105/407 - (25%)
Similarity:185/407 - (45%) Gaps:61/407 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 LNIDDFKEIILSAEPN-----FEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVK-TFSYI 544
            |:::.|::|....||:     ||....|..      |||:.:.|.::::..  |..|:| ..:.|
  Fly    26 LSLEVFQDIFKHVEPDVQIDAFELAQGSDR------GDNYTAALYRIKLTG--KRRSLKWEQNVI 82

  Fly   545 LKVHSDNDAIN--FSDFNLFPKEIEVYSTYVPAFERFY---KDVGLPVTFS--PKSFRLSKDVSK 602
            .||..::....  :....||..|::.|:|.:|...:|.   .:...|| |:  ||.:....|:  
  Fly    83 CKVMPESVVAREAYKSDKLFRNEVQFYNTIMPELLKFQASKTNQDTPV-FNAIPKCYSARHDL-- 144

  Fly   603 EYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYK-----ELNGPYSPKYNNGIF 662
              |::|:|:..||:|.||..|:.||.::..|.::||.|..||.||     |.:...| ..:.|||
  Fly   145 --LIMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCS-MISEGIF 206

  Fly   663 TEQTAPIFKGMFVNTKKSFIEEVSKFDGVD-EYLHKMPEILD--TYVDRILEDAKINEQAFNVLN 724
            .......::..:....|:.|:.||:....| :|:..|.:..:  ::..|:::.|. .|...:.:.
  Fly   207 CTANTSWYRNYYERLTKNAIQMVSEVLPPDSKYVLAMNKFAESSSFFGRMVKLAS-TESPLSAIC 270

  Fly   725 HGDAWINNIMFQY--ESDGRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWY 787
            |||.|:||.::.|  |...||.|..|||.|:.:|.:.|.|:...:...|..:::..|...|::.|
  Fly   271 HGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTLLKIY 335

  Fly   788 HQ-----------NMKEHAKLLNYNGFIPSLKELHA-ILIQHPIFAAGTVLTTL--SMCLNKTTD 838
            .:           |:.:|...|.      .|::|.| .|..:..||.|..|..|  |.|.::...
  Fly   336 TEELFRWLQMLCTNLPDHCDTLQ------KLQDLFAEELKTYGRFALGLALDILPISTCSSEDAP 394

  Fly   839 DFTTDSFLGNEENGKSL 855
            |...|.   ::|.|:.:
  Fly   395 DMYLDR---SDELGEDV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 82/312 (26%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 79/298 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.