DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG16898

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster


Alignment Length:433 Identity:120/433 - (27%)
Similarity:205/433 - (47%) Gaps:48/433 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LVPKWLNQTQFE-ELLAADVDQFSKIVGFRVKPAMAPGENYATLMLRISIDVELTDKSTKLVSFM 108
            ::|.||.:...: :|.|...|...|:|....|||...|:||.:||.||.::::..|...:..:::
  Fly     1 MLPNWLTEEYLQPKLRAYYKDDQLKVVKVWAKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTYI 65

  Fly   109 MK--VPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAFKLDATKEPKVA 171
            :|  :..|.||.:..:.. :.:..|...|..|||||.||.:..||..||......:|     :..
  Fly    66 IKESLSEDCPQAKVFLEY-DVYNREMDMYEFILPKMNELLQEVGLTGKFTADTIFVD-----REY 124

  Fly   172 NTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPD-----IFVNGVM 231
            .|:::.||.|..:.|.:|::.|:|..||..|..||:||||...:.|.|   |:     :|::...
  Fly   125 RTIILEDLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRH---PELLTKSLFIHCFS 186

  Fly   232 GNNKEAIIAFMEGMLASFRTSFMANLDKFKNGEEYREKLEKALAGLTMEFMKLGI----VDPNEF 292
            .:|| ......||:|::| ..|:......|  ::|..||:|    :....|..|.    |...|.
  Fly   187 RDNK-GYTEVYEGVLSAF-IRFINEQPVLK--KKYGNKLQK----IHENIMDYGARTFEVGEQEL 243

  Fly   293 NALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFDFFIR 357
            ..|:|||||..|.|::.:.:.:.:..|.:|||...:.||..||..|...|:: |.........:.
  Fly   244 LTLSHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLR-DEVQDMESVLVE 307

  Fly   358 HYQEALVKHLGILGFTGRKPSLRELHR--------TLIKYGGWVLFPTISVLPLVLLDPTQ-SAT 413
            .|...|..::..|.:.|..|||:...:        .|:.:    ||.     |:::.|.|: |:.
  Fly   308 KYYSDLKTNVDTLSYKGIFPSLQGFQKQFESRRFMCLLAH----LFK-----PVIIYDGTEVSSD 363

  Fly   414 FDNFMSDSADGVSFRGSLYANKRCQEYIERILPWLDNRGFLEV 456
            |.:...|:.:|:.|:.::|||:|..:...::|..||.:|.|.:
  Fly   364 FSSVYKDTEEGIRFQKAIYANERVLKSATKLLAMLDAKGVLNL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 85/302 (28%)
EcKinase 516..800 CDD:281023
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 85/302 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459404
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.