DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and JhI-26

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster


Alignment Length:467 Identity:102/467 - (21%)
Similarity:186/467 - (39%) Gaps:86/467 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KWLNQTQFEELLAAD--VDQF--SKIVGFRVK----PAMAPGENY-ATLMLRISIDVELTDKSTK 103
            :||..|....:|...  ||.:  ||:..|.|.    ..:...|.: .|...|.:|:.|...:..:
  Fly     9 QWLRYTVLPSILRNGRLVDNYSESKVTTFHVGDIDIDVIGHSEAFMLTFCYRTTINFEYDGQKFQ 73

  Fly   104 LVSFMMKVPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKF-APRAFKLDATKE 167
            ....:.|.|...|:|.:.:.....||:|...||||||:.:     |..|.|| ||:.:..:..:.
  Fly    74 RKMVVKKTPAMPPEMYESIQFGPLFTNEINFYTEILPEFQ-----KFTDGKFAAPKYYYGELNQH 133

  Fly   168 PKVANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDIFVNGVMG 232
            ..||   ::.:..:.|::.......|:|:....|::.|.:||.....|...:   |:.|.. :..
  Fly   134 SAVA---ILENFAEQGWRVTKDRVGLSLQHAMIAVSYLGRFHGFAYAMKHKN---PEKFAQ-LTD 191

  Fly   233 NNKEAIIAFMEGMLASFRTSFMANLDKFKNG-----EEYREKLEKALAGLTMEFMKLG--IVDPN 290
            |.||:..| .:.:...::.:...::|:....     .:..|:..|....:..::.:.|  .|.|.
  Fly   192 NLKESRYA-NDNIHPEWKLTMKTSIDRAAKAVATYQPQIDEEFVKKFCFMISDYSQYGRQRVAPR 255

  Fly   291 E-FNALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFDF 354
            | ...|.|||...||:.::.:...:.::::..|:|..:..||.:||..|:..|:..:.:..:|:.
  Fly   256 EPLATLCHGDYVRNNVAYRYDDKEEPQEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEVRDPNFEA 320

  Fly   355 FIRHYQEAL----VKHL--GILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSAT 413
            ....|..||    .:|.  .:..|..|...|:|    .:::..:.|..:.|.| :.|:||...:.
  Fly   321 IFCEYTLALHNSYREHAKEEVPDFLSRGELLKE----YVRFLPYSLSISASFL-MSLVDPLDISP 380

  Fly   414 FDNFMSDSADGVSFRGSLYANKRCQEYIERILPWLDNRG--------------FLEVS------- 457
            .:.|....:|              :|.|||.:    |||              .||:|       
  Fly   381 EEMFALQLSD--------------EEIIERTM----NRGGEVVDREVAHQVKEMLELSQATGVSI 427

  Fly   458 -----TDPLPPE 464
                 .|.||.|
  Fly   428 DDGIDLDKLPKE 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 66/307 (21%)
EcKinase 516..800 CDD:281023
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 63/288 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.