DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG9259

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:415 Identity:103/415 - (24%)
Similarity:180/415 - (43%) Gaps:63/415 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 FKEIILSAEPNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDN-SVKTFSYILK---VHSDN 551
            |.:.:.:::..|: |::.|.|..:.....:....|.:.:..:|.:: .|:..::..|   |.:::
  Fly    20 FHQDVSNSDTGFD-IVNYTLKPTSDAPAGYLGSHLYLHVTLKLHNSEEVRQLTFFSKSAPVGNES 83

  Fly   552 DAINFSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVSKEYLLLENLQPSGFK 616
            ......||.:|.|||.||...:|...:...:|      :||.:...|::    |:.|||...|::
  Fly    84 RMEYLEDFGVFEKEIAVYQNVLPDLHKACAEV------APKCYYADKNL----LIFENLADQGYR 138

  Fly   617 MVDRMIG-MDLEHSKCTLKKLAQWHAASLKYKELNG-------PYSPKYNNGIFTEQTAPIFKGM 673
            |.....| :..|...|.||.||..||.|:..::..|       |.|...|  .:....:|....|
  Fly   139 MGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVEN--AYPSDVSPEHMRM 201

  Fly   674 --FVN---TKKSFIEEVSKFDGVDEYLHKMPEILDTYVDR---ILEDAKINEQAFNVLNHGDAWI 730
              |.|   ..|.||:.:.|      |..|:..:|:.:.::   |.|..|.::...|.:.|||.|.
  Fly   202 VNFQNACLVLKEFIKLIPK------YQSKLDYVLENFTEKMSFIFEAVKTSDVYQNTILHGDLWA 260

  Fly   731 NNIMFQYESDGRVK-ETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEH 794
            |||||||...|.|. :..|:|.|:.:|..|..|:...:...|..:.:......|:..|::.|.|.
  Fly   261 NNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAHLSELLAEYYRFMTEF 325

  Fly   795 AKL--LNYNGFIP------SLKELHAI-LIQHPIFAAGTVLTTLSMCLNKTT------DDFTTDS 844
            .|.  |:...|||      |:::..:: ||:..:|....:|.  ..|..|.|      :||.|:.
  Fly   326 LKRADLDIARFIPEQTFYESVQKFRSVGLIESCLFCHLVILP--PHCTQKLTSSVDGFNDFFTNK 388

  Fly   845 FLGNEENGKSLREAMFSNERYRANI 869
            .:      :...||..::|.||:.:
  Fly   389 RI------EICLEAFNTDELYRSRL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 79/306 (26%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 76/288 (26%)
APH <252..325 CDD:279908 23/72 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459717
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.