DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and F59B1.10

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:341 Identity:84/341 - (24%)
Similarity:144/341 - (42%) Gaps:78/341 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 EKILSSTSKL-ATKPGDNFASKLLKVEI-----EAQLKDNSVKTFSYILKVHSDNDAINFSDFNL 561
            |..|::.||: ....|:.|:|::|.:..     .|.|....:......:.:.:..|.....:.:|
 Worm    36 ESELTAESKMEVIGDGNGFSSRVLLISCNWTIPSAHLPKKLILKIVSFVHIQALIDKGKQQNASL 100

  Fly   562 FPKEIE--VYSTYVPAFER-------FYKDVGLPVTFSPKSFRLSKDVSKEYL---LLENLQPSG 614
            ..||:|  :|:.:..:.::       ||:..|   .|:.|:..    :.|.|.   |.|.....|
 Worm   101 ITKEVEEQMYAYFESSCKKMHNQEMNFYEVAG---KFNSKTLL----IPKVYFYTKLDEKNSNKG 158

  Fly   615 FKMVDRMIGMDLEHS--KCT-------LKKLAQWHAASLK-----YKELNGPYSPKYNNGIFTEQ 665
            |..::.:.|..:.||  .||       |:.:|:..|.||:     .|:|.     |.:||...::
 Worm   159 FIGMEYVEGSIVRHSYDTCTIEEIQPILRAIAKLQALSLQNPAEISKDLQ-----KIDNGAIFQE 218

  Fly   666 TAPI------FKGMFVNTKKSFIEEVSKF-DGVDEYLHKMPEILDTYVDRILEDAKINEQAF--- 720
            |..:      .||:|...:..   |.|:| :.||....|..||||.            |:||   
 Worm   219 TLKMMLSESGIKGIFEQCRNL---ERSRFGEKVDRIEEKRNEILDF------------EKAFNLN 268

  Fly   721 -------NVLNHGDAWINNIMFQYESDGRVKETLLLDHQVTKYGNPAQDLYYFIMSS-TQLDIKV 777
                   |||.|||.|..|.::. |::|....|.::|:|::..||||:||...::|: |..|.:.
 Worm   269 KVVGIKQNVLCHGDLWAANFLWT-ENNGVFCATRIVDYQMSHLGNPAEDLVRLLVSTITGADRQA 332

  Fly   778 DQFDYLIRWYHQNMKE 793
            .....|.::|...:.|
 Worm   333 HWQQILEQFYSYFLNE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 80/327 (24%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 84/341 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.