DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG9497

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster


Alignment Length:417 Identity:103/417 - (24%)
Similarity:196/417 - (47%) Gaps:29/417 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 PDWLNIDDFKEIILSAEPNFE-KILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVKTFSYILK 546
            |..|::..|:|::.:|..... ::||...::.:..|:|:.|::.:|::..:..|:..:..::|:|
  Fly    14 PSHLDVPFFEEVLETALRTARVQLLSIHIRMGSSTGENYCSQIYRVKVSFKRPDHPEQHMAFIVK 78

  Fly   547 VHSDNDAINF-SDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVSKEYLLLENL 610
            .....|::.| .|..::.||...|...:|..|...:   ....|.||.:...|. .:..|:.|:|
  Fly    79 SIPHLDSVEFIDDLQVYLKEKITYYEVLPRLELLMQ---CNRRFGPKLYHYLKQ-PENSLVFEDL 139

  Fly   611 QPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIFTEQTAPIFKGM-- 673
            ...||.|..|.:|::.||.:..:::||::||.|:....::......|.:|:.:.:......|:  
  Fly   140 AEKGFVMASRELGLNEEHCQLVMERLAEFHATSMALAVVDPHIFDAYGDGMLSPRGLAKDDGLLM 204

  Fly   674 --FVNTKKSFIEEVSKFDGVDEYLHKMPEILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMFQ 736
              |....|.....||.:.|.::...|:.:.:......:.......|:...||||||.|:||::|:
  Fly   205 QFFSGNGKELHHLVSTWPGFEKIAEKIGKYMQNQRANLERSQAPQEKEVKVLNHGDLWVNNMLFK 269

  Fly   737 YESDGRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLNYN 801
            |:...|.::.:|:|.|::.:|:|..||.||..:|..|::...:...|:|.||..:.:....|:..
  Fly   270 YDGAQRPQDLILIDFQLSVWGSPGIDLNYFFYTSLTLEVLRHRRTQLLRTYHARLAKTLLDLDMG 334

  Fly   802 GFIPS----LKELHAILIQHPIFAAGTVLTTLSMCLNKTTDDFTTDSFLGNEENGKSLREA---- 858
            ..:||    |:|:|. ...:..||:..:..|:|....:|.|:        |.||.|....|    
  Fly   335 IPVPSYEQILEEVHR-RESYGFFASYGIFPTVSQDKAQTADN--------NLENFKDADFAKQKV 390

  Fly   859 --MFSNERYRANIERVMPWINRRGLLD 883
              ||.:.|....:...:|...|.|:||
  Fly   391 RQMFQSRRLADTLRYTLPHFERAGVLD 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 72/288 (25%)
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 71/285 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459270
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.