DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG33511

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:477 Identity:104/477 - (21%)
Similarity:188/477 - (39%) Gaps:135/477 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LLAADVDQFSK-IVGFRVKPAMAPGENYATLMLRISIDVELTDKSTKLVSFMMKVPH-DTPQMEQ 120
            |:.:.||..|| ::|:.       ||.|   .|.:..:|:...|...|..|:..:|. :.||.|:
  Fly    27 LINSQVDAGSKDLMGYM-------GEYY---KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREE 81

  Fly   121 MMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAFKLDATKEPKVANTVL-MHDLGQNGF 184
             ......|..|:|.|::||||::: |..|    |..|:.:        ...|.:| :.||.|: :
  Fly    82 -CERKGVFQKESALYSQILPKIQK-YATK----KLYPKCY--------YSRNDILVLEDLTQD-Y 131

  Fly   185 KNINRLECLNLEQTKFALTRLAQFHAAGATM-----VQVHGPYPDIFVNGVMGNNKE------AI 238
            :::...|...|:..|..|..|::.|||....     |:::..|.::.:...:.:|..      ..
  Fly   132 RHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNNSWYITGLKA 196

  Fly   239 IAFMEGMLASFRTSFMANL--DKFKNGEEYREKLEKALAGLTMEFMKLGIVDPNEF--NALNHGD 299
            |.|:......|:|....|.  ||..|.....|:|                |.|::.  |.|.|.|
  Fly   197 IVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEEL----------------VAPSKTIRNVLCHRD 245

  Fly   300 CWMNNLLFKMNSSGDL--EDMVFVDFQNPKYGSPAMDLLY--FIISSVQIDYKLSHFDFFIRHYQ 360
            .|.:|:::..|....:  .....||||..:|.||.:|:|:  :|::|.::  :.:.:|..:.||.
  Fly   246 TWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEV--RRAIYDECLEHYY 308

  Fly   361 EALVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSATFDNFMSDSADGV 425
            :.|..||..||          |.:.||                         |.:||        
  Fly   309 KNLQHHLDRLG----------LDKNLI-------------------------TENNF-------- 330

  Fly   426 SFRGSLYANKRCQE-YIERILPWLDNRGFLEVSTDP---LPPELLAALKPQQPQPENTDQIPDWL 486
                    .|.||. .:..::.|        ..|:|   :.|.:...|:.::|     ::...:|
  Fly   331 --------RKECQRTRLAALVIW--------ALTEPQTKMSPSISNRLRSEEP-----EKFDYYL 374

  Fly   487 NIDDFKEI--ILSAEPNFEKIL 506
            |.|..:.:  ::..:|.:|:.:
  Fly   375 NCDRSELLLRVIEIQPGYEETI 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 77/312 (25%)
EcKinase 516..800 CDD:281023
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 77/320 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459716
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.