DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and AgaP_AGAP003760

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_559536.2 Gene:AgaP_AGAP003760 / 3290897 VectorBaseID:AGAP003760 Length:406 Species:Anopheles gambiae


Alignment Length:362 Identity:98/362 - (27%)
Similarity:171/362 - (47%) Gaps:42/362 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 NTDQI--PDWLNIDDFKEIILSA--EPNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNS- 537
            |.|::  |.|||.:.|::::..:  :|..|.|.....:..|..||::||.:.:..:..:.:.:| 
Mosquito     3 NQDELEAPGWLNDEFFRDVMRESNNDPTIELIKPCVLRPGTNKGDHYASVMFRTTVTYRSQRSSE 67

  Fly   538 VKTFSYILKVHSDNDAIN---FSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKD 599
            .::.:.|:|..|:.|.:.   ..|..||..|||:||..:|...|..|::|....:....|...| 
Mosquito    68 EQSANIIMKTKSEADGLKKELLDDDRLFAIEIEMYSKVLPEMTRMLKEIGEEYKYPRYIFGALK- 131

  Fly   600 VSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIFTE 664
             ....|:||::...|:.|.|.:  .:|:..|..:|.:|.:||||:..:..:..::.::...:..:
Mosquito   132 -PHTILILEDISDQGWVMGDLI--NNLDDMKPIVKDIAMFHAASVMLESADSTFAERHAYSMSDK 193

  Fly   665 QTAPIFKGMFVN--------TKK-----SFIEEVSKFDGVDEYLHKMPEILDTYVDRILEDAKIN 716
            ...  |:||...        ||:     .|.:.:.||         ...:.:.||...::...|.
Mosquito   194 FVG--FEGMITKGFGDLMHLTKRYPEFAHFAKPLQKF---------QDSLRELYVSSYIQSKTIQ 247

  Fly   717 EQAFNVLNHGDAWINNIMFQYESDGRVKETLLLDHQVTKYGNPAQDLYYFI-MSSTQLDIKVDQF 780
                |||.|||....|::.|.::.||..:|:|||:|:..:..||.|:||.: |..|| .:|....
Mosquito   248 ----NVLIHGDFHGKNMLHQVDAKGRHTDTILLDYQICCWTTPAVDVYYLLDMIPTQ-KVKDKHR 307

  Fly   781 DYLIRWYHQNMKEHAKLLNYNGFIPSLKELHAILIQH 817
            ..||..|:|...:..|.|.|.|.||||.:|...|::|
Mosquito   308 SELIYMYYQQYSDLLKRLGYVGKIPSLLDLQIELLRH 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 78/301 (26%)
AgaP_AGAP003760XP_559536.2 PKc_like 45..327 CDD:304357 78/301 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.