DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG31099

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:409 Identity:127/409 - (31%)
Similarity:229/409 - (55%) Gaps:19/409 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 QIPDW---LNIDDFKEIILSAEPNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVKTFS 542
            :||||   |:::.....:|........::.|...:..:.    .:.||.::::.||:|.::|...
  Fly     5 KIPDWVSSLSLNQAVHSVLEDGVQITSVIPSVHLIQFRN----CTVLLPIQVKVQLRDFTMKKLF 65

  Fly   543 YILKVH--SDNDAINFSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVSKEYL 605
            ::||..  :|..|:..:...:|.:|.:||...:|..|..|::||..|:|.|::|||...:..:|:
  Fly    66 FLLKAQHGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQYV 130

  Fly   606 LLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIFTEQTAPIF 670
            |||:|:...:|.|:|..|.:....|..||||||:||||....|.:|.:|....||::|:....:.
  Fly   131 LLEDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEKHGAFSNLLVNGVYTKANESVL 195

  Fly   671 KGMFVNTKKSFIEEVSKFDGVDEYLHKMPEILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMF 735
            :.:  |..:.|:.::.::...|.:..::.|.....||.:|:....:...||||||.|.|:||:||
  Fly   196 QEL--NDPEIFLSQLRRWRLGDHFHKRLVEKEKDLVDGLLKLHSPDSNEFNVLNHSDCWVNNVMF 258

  Fly   736 QYESDGRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLNY 800
            :::..|.|::|.|||:|:.|||:||.||||.|:||.:.|||:.|||.::::|..::.::.|.||:
  Fly   259 KFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDNLKALNF 323

  Fly   801 NGFIPSLKELHAILIQHPIFAAGTVLTTLSM-CLNKTTDDFTTDSFLGNEENGKSLREAMFSNER 864
            .|.:|.|:.:...|.::.:.|...|...|.: .:|:..|:.       ||.....::.|||::.:
  Fly   324 GGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQFEDEV-------NERYASKMKCAMFTSRK 381

  Fly   865 YRANIERVMPWINRRGLLD 883
            |...|:.::||:..|.||:
  Fly   382 YIQAIKDILPWMEERSLLN 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 98/285 (34%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 98/280 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442521
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101022at50557
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.