DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG31975

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster


Alignment Length:432 Identity:110/432 - (25%)
Similarity:187/432 - (43%) Gaps:69/432 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 DQIPDWLNIDDFKEIILSAEPNF--EKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVKTF- 541
            |::|:   |....|::   ||:.  .::|:..:...||||||:.|.||  .|.|:|:.::.::| 
  Fly     4 DKLPE---IRALSEVV---EPHVSGSRLLNYHTSSLTKPGDNYGSVLL--AIHARLQKSNGESFE 60

  Fly   542 -SYILKVHSDNDAINFSDFNLF-PK-----EIEVYSTYVPAFERFYKDVGLPVTFSPKSF----- 594
             ..:.||    ..|:...:..| |:     |..||....||......:.|:|.....|.|     
  Fly    61 EQLVAKV----PPIDPKYWQFFQPEQTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYG 121

  Fly   595 ---RLSKDVSK----EYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGP 652
               .|..:.||    ..|:||||:.||:....|:...||.|:...||.:|::||.||..:.|.  
  Fly   122 CRESLESNSSKVDQNAVLVLENLRSSGYVSGQRLKAFDLAHTLLALKYMAEFHALSLALRILR-- 184

  Fly   653 YSPKYNNGIFTEQTAPIFKGMFVNT---------KKSFIEEVSKFDGVDEYL-HKMPEILDTYVD 707
              |:    :|.||..|.||....:.         |...:|::.:....|..| .:|.|:.|.:.:
  Fly   185 --PE----VFREQVRPFFKKFDWHAEAPEWKSVMKAETLEDIRRATNNDSRLVARMKELSDQFFE 243

  Fly   708 RILEDAKINEQAFNVLNHGDAWINNIMFQYESDGRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQ 772
            .:.......:..|..:.|.|.|||||||:|...|...|..::|.|..:|.:...|:..|::||..
  Fly   244 FLAAAPDRPDGPFTSIIHCDFWINNIMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVD 308

  Fly   773 LDIKVDQFDYLIRWYHQNMKE-----HAKL--LNYNGFIPSLKELHAILIQHPIFAAGTVLTTLS 830
            ..|...:|::::..|::..:.     .|||  ..:..|...:|.:..|.:.|.||....:|...:
  Fly   309 TAILEVEFEHMLEAYYEAFERCLRRVGAKLEVHTFKEFRLEVKRVAYIQVPHAIFMTRFILADSA 373

  Fly   831 MCLN-------KTTDDFTTDSFLGNEENGKSLREAMFSNERY 865
            :..:       |.||....   .|:|...:.|.:.:...|::
  Fly   374 LIGDSEAEERPKLTDVLKN---TGSERISRKLSQILNLAEKF 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 87/320 (27%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 84/312 (27%)
APH <214..329 CDD:279908 29/114 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459617
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.