DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG31436

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster


Alignment Length:428 Identity:108/428 - (25%)
Similarity:197/428 - (46%) Gaps:30/428 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 PQQPQPENTDQI--PDWLNIDDFKEIILSAEPNFE-KILSSTSKLATKPGDNFASKLLKVEIEAQ 532
            ||..| .|.|::  |:|||.:....::...|.... |::..|...|:..||::||.:.:..::..
  Fly     5 PQNNQ-FNDDELVPPEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKYT 68

  Fly   533 LKDNSVKTFSYILKVHSD-----NDAINFSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPK 592
            .:....:. |.|:|...:     .|.:..|.  :|..|:.:|:..:|.|||..:.||........
  Fly    69 NRKGEFQK-SLIIKTMPEAEGHKKDMLGGSP--IFETEMGLYTKVLPEFERILRQVGDDTQLYVN 130

  Fly   593 SFRLSKDVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKY 657
            ....|.: ..:.|:.|:|...|: :|.|.....|:..:....|||:|||.|||.:.....:...|
  Fly   131 CIYHSLE-PHQVLIFEDLAEMGY-IVLRDRDATLDEIRRIYFKLAKWHAVSLKVQNEQPEFLESY 193

  Fly   658 NNGIFTEQTAPIFKGMFVNT-KKSFIEEVSKFDGVDEYLHKMPEILDTYVDRILEDAK-----IN 716
            .:|:|  :...:....|:.| .:.|:|.:.|...:::|......|.|.:::|::|:.|     ..
  Fly   194 THGLF--EMPHVLNDPFMRTGMEFFVELLGKEPELNKYKPYFESIKDDFLERLVEEWKDIRKSQK 256

  Fly   717 EQAFNVLNHGDAWINNIMFQYESDGRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFD 781
            :..:.||.|||..:.||||:::....:::.:|||.|::.......||.|.|....:.:.:.:.:|
  Fly   257 KDEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWNNWD 321

  Fly   782 YLIRWYHQNMKEHAKLLNYNGFIPSLKELHAILIQHPIFAAGTVLTTLSM--CLNKTTDDFTTDS 844
            .||.:|...:::..|.:.|.|.:||...|...|.||..:....:.|.|.:  .|...:.||  ..
  Fly   322 DLINYYISVLQDVLKKIGYKGVMPSQSGLWKRLHQHKYYEFFLISTFLPLMWALRDKSVDF--GD 384

  Fly   845 FLGNEENGKSLREAMFSNERYRANIERVMPWINRRGLL 882
            .|.|||   ..|:..|| :.|...:..::..:::.|||
  Fly   385 LLQNEE---KRRKCSFS-KGYIKEVTILLARLDQLGLL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 71/294 (24%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 71/294 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459821
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.