DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and CG32195

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:430 Identity:114/430 - (26%)
Similarity:199/430 - (46%) Gaps:76/430 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 ILSAEPNFEKILSST------------SKLATKPGDNFASKLLKVE-IEAQLKDNSVKTFSYILK 546
            |.||| .||:.|:..            .|..::.|:||.|.:.:|. :..:..|.::::..||||
  Fly     5 IYSAE-YFERALARAYGCEMLRVENFHIKAVSQKGENFCSVIYRVALVFRRSPDGALESGKYILK 68

  Fly   547 VHSDNDAINFSDFNLFP-------KEIEVYSTYVPAFERFYKDVGLPVTFSPKSF---RLSKD-- 599
                         :|.|       .|.:::...:||.:...::       :||..   :||.|  
  Fly    69 -------------DLLPAAAALGTNEKDMFEVLLPAMQAILEE-------APKEIGEHKLSADCL 113

  Fly   600 -----VSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASL----KYKELNGPYSP 655
                 ..||..:||:|...|::..||..|::||.:|..::||||:|.||.    |..||....||
  Fly   114 LVEISAGKELYILEDLGALGYESFDRRQGLNLEEAKICVRKLAQFHGASKVLYEKKPELIQRLSP 178

  Fly   656 K-YNNGI---FTEQTAPIFKGMFVNTKKSFIEEVSKFDGVDEYLHKM-PEILDTYVDRILEDAKI 715
            . |.||:   |.:  |.:.:|. ....::|.||      :.|...|| .:|...|..|:.:....
  Fly   179 SHYANGLNDRFAQ--ALVLEGA-EYAAEAFAEE------LPEISKKMKAQIPKAYTKRMRDVVDP 234

  Fly   716 NEQAFNVLNHGDAWINNIMFQYESDGRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQF 780
            |:.:.|.:.|||.|:|||||.:.:    |:..|:|.|...:|:||.|||:...:|.:.::.::..
  Fly   235 NKSSLNAVIHGDPWLNNIMFDFVN----KKATLVDFQNCYWGSPAIDLYFLFYTSLKPELLLNNQ 295

  Fly   781 DYLIRWYHQNMKEHAKLLNYNGFIPSLKELHAILIQHPIFAAGTVLTTLSMCL--NKTTDDFTTD 843
            |.|:.:|..|:.|..:...|...:|:..:|...:.:...:...||:..|.:|.  .:.:.||...
  Fly   296 DELLNYYFDNLLETLRHCGYKDTLPTFGQLKDEMKRCLFYGYYTVVCELPICCASPEASVDFGVH 360

  Fly   844 SFLGNEENGKSLREAMFSNERYRANIERVMPWINRRGLLD 883
            :|:..:...|. |..:|::||.|..|:..:...:|.|:|:
  Fly   361 TFVDTDAMLKK-RHQLFASERVRQTIKATLLMFDREGILE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 86/310 (28%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 86/310 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459484
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.