DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and T16G1.3

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_506237.2 Gene:T16G1.3 / 188553 WormBaseID:WBGene00011797 Length:389 Species:Caenorhabditis elegans


Alignment Length:369 Identity:93/369 - (25%)
Similarity:148/369 - (40%) Gaps:79/369 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 NFEKILSSTSKL-ATKPGDNFASKLLKVEIEAQLKDNSVKTFSYILKVHSDNDAINFSD-FNLFP 563
            |.|..|...:|. ....|:.|.|:::.||.:..:....:.. .::||:.|....:|..| .||..
 Worm     2 NTEARLGENTKFTVVGDGNGFMSRVILVEPDWTVHGEHLPN-RFVLKITSCMHVLNVLDQMNLQD 65

  Fly   564 K-EIEVYSTYVPAFE---------RFYKDVGL----PVTFSPKSFRLSKDVSKEYLLLENLQPSG 614
            | |..::|.:  .:|         ..|:.:|.    .|..|||.|...|..|      |||....
 Worm    66 KSESALWSIF--EYEAQGLHNREVNLYEIIGKWNMDDVLMSPKVFFSKKFDS------ENLTKGF 122

  Fly   615 FKM------VDRMIGMDLE----HSKCTLKKLAQWHAASLKY--------------KELNGPYSP 655
            |.|      :.|.:.::|:    ||  .||.||.:.|.|||.              |.:...:|.
 Worm   123 FAMEYVDNAITRHLYINLKSYELHS--ILKSLAVFQAESLKLNKREQESVTGYDLEKIVGKMFSQ 185

  Fly   656 KYNNGIFTEQTAPIFKGMFVNTKKSFIEEVSKFD--GVDEYLHKMPEILDTYVDRILEDAKINEQ 718
            ...|.|| ||...|       .|:...|...|..  ||:.....:.:.|:.|:.       |.: 
 Worm   186 NGLNSIF-EQVRQI-------NKEELSEAADKIAVFGVELVNFDLVKNLNNYLG-------IKK- 234

  Fly   719 AFNVLNHGDAWINNIMFQYESDG-RVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDY 782
              |||.|||.|..|||::...|. ||.:  ::|:|....||||:||....:|:.....:...::.
 Worm   235 --NVLVHGDLWSANIMWKENKDEFRVDK--IIDYQSIHLGNPAEDLVRLFISTLSGSERQKYWEK 295

  Fly   783 LIRWYHQNMKEHAKLLNYNGFIPSLKELHAILIQHPIFAAGTVL 826
            |:..:::...|..:..|....:..|||.:.:     .|..|::|
 Worm   296 LLEQFYEYFIEALEDKNVPYTLEQLKESYRL-----YFVTGSLL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 82/325 (25%)
T16G1.3NP_506237.2 PKc_like 1..381 CDD:389743 93/369 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.