DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and H37A05.2

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_506379.1 Gene:H37A05.2 / 186806 WormBaseID:WBGene00010426 Length:419 Species:Caenorhabditis elegans


Alignment Length:373 Identity:84/373 - (22%)
Similarity:146/373 - (39%) Gaps:82/373 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GFRVKPAMAPG--------ENYATLMLRISIDVELTDKSTKLVSFMMKVPHDTPQMEQMMSMANF 127
            ||..|.||...        ||...|..||::.:   .....|.:|...|..:|..:|:|.||.:.
 Worm    48 GFMSKIAMIQADWIPRFDTENAQNLPDRIAVKM---SSELSLYNFSTLVSSETWDIEKMKSMTSL 109

  Fly   128 FTSENAAYTEILPKMEELYKAKGLDIKFAP--RAFKLDATKE--PKVANTVL-----MHDLGQNG 183
                   ..|:..:..::|:....:....|  ....|:|..|  |..|..:.     :|.:|.| 
 Worm   110 -------VKELHNREVDMYRIIMREKPACPTVNVLSLEAFTELSPLKAYIISEYIPNLHHVGMN- 166

  Fly   184 FKNINRLECLNLEQTKFALTRLAQFHAAGATMVQ---VHGPYPDIFVNGVMGNNKEAIIAFMEGM 245
                   :|:::|:....:..:|.|.|.|.:|.:   ......:|::       :||:..|.:..
 Worm   167 -------DCISIEEIWAVVDGIAAFSAMGESMSEDEKKKSTIGEIYI-------EEAVKYFFDDQ 217

  Fly   246 LA-SFRTSFMANLDKFKNGEEYREKLEKAL------AGLTMEFMK--------LGIVDPNEFNAL 295
            .. :.|.:.:..|     |..|.||:|:|:      .| :.|..|        ||     ....|
 Worm   218 SPDNMRKNLIMIL-----GVAYEEKVEEAMDIFDLYCG-SSEIQKNYSRVSAFLG-----HSPVL 271

  Fly   296 NHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSV-QIDYKLSHFDFFIRHY 359
            .|.|.|.:||||.::|...||....:|||.....||.:|:....::.: :.|.:....:...|:|
 Worm   272 MHSDIWPSNLLFSLSSENKLEFKALIDFQTASLSSPGLDVGCLTVTCLSKKDRRTVQSEILDRYY 336

  Fly   360 QEALVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFP--TISVLPLVL 405
             ::.||.|       :.|:.....|..::....:.||  .|.:||.:|
 Worm   337 -KSFVKSL-------KTPNSIPYTREQLEDSYELCFPASVILMLPFIL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 71/327 (22%)
EcKinase 516..800 CDD:281023
H37A05.2NP_506379.1 DUF1679 3..409 CDD:369592 84/373 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.