DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and H06H21.8

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 / 186700 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans


Alignment Length:404 Identity:87/404 - (21%)
Similarity:167/404 - (41%) Gaps:75/404 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 IDDFKEIILSAEP---NF-EKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVKTFSYILKVH 548
            :...:.::.|:.|   || ||:.:|..||  :...:|.|::....::. :.|......|..:||.
 Worm     5 LKQLRRLVESSFPEIENFHEKVDASFEKL--ENAKSFWSEIYVAHLKV-VGDGVKVPESVFIKVP 66

  Fly   549 ---------SDNDAIN-FSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVSKE 603
                     .|..|:| .:|..|:      ||.....|.:.::...:|....||.: .::|::.|
 Worm    67 RISENVLRCEDESAVNHLNDVLLY------YSKKENLFYKHFEYGSIPNFPFPKVY-FTEDINGE 124

  Fly   604 Y---LLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIFTEQ 665
            .   ::.|||....| .|:.:.|:..|.....::.||..|:..:|..:.:  |...:..|....:
 Worm   125 ATGGIVAENLSEKVF-AVEHIPGLKHEQILRLMEALAGLHSFLMKRDDKS--YVESFVEGAHGRE 186

  Fly   666 TAPIFKGMFVNTKKSFIEEVSKFDGVDEYLHKMPEILDTYVDRILE-----DAKINEQAF----- 720
            |  ..:||    :....||....:.|.      ||:...  |||..     |..|..:|.     
 Worm   187 T--FSEGM----QNMMFEEALTLENVS------PEVFGN--DRIRNIKWSFDYSIKNKATADAIS 237

  Fly   721 ---NVLNHGDAWINNIMFQYESDGRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDY 782
               .::.|.|..:.|::::.:| .:.:.:.::|:|:...|:.|.|:...:......:|:......
 Worm   238 AFPGIICHADLNVTNVLWKKDS-AKDEISAIIDYQMLFIGSIAFDIIRVLTLGLNREIRRKMTQN 301

  Fly   783 LIRWYHQNMKEHAKLLNYNGFIP-SLKE-LHAILIQHPIFAAGTVLTTLSMCLNKTTDDFTTDSF 845
            .:..||:.:.|.:     ||..| |::| ||...:.:| |::...|..:::.:.     ..:|..
 Worm   302 YLDHYHKTLTELS-----NGKAPFSMEELLHQYSLIYP-FSSNFSLFGIALYIK-----MYSDGT 355

  Fly   846 LGN----EENGKSL 855
            |||    |||.|.|
 Worm   356 LGNPEDKEENCKEL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 59/309 (19%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 39/200 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.