DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and F48G7.12

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_503277.2 Gene:F48G7.12 / 186000 WormBaseID:WBGene00018623 Length:435 Species:Caenorhabditis elegans


Alignment Length:347 Identity:67/347 - (19%)
Similarity:128/347 - (36%) Gaps:107/347 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 LNIDDFKEIILSAEPNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVKTFSYILKVHSD 550
            :.::|.:::|........::..:|.......|:.|:|:::.||.|..:.|..:.. .::||:.| 
 Worm    22 VQLEDVQKVIGEQMNTKARLGENTKYTVIGDGNGFSSRVILVEPEWTVSDKHLPE-KFVLKITS- 84

  Fly   551 NDAINFSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVSKEYLLLENLQPSGF 615
                               ..:||......|... |.||..:...|......|...|.|.:.:.:
 Worm    85 -------------------CLHVPGLIEQMKGKN-PGTFPAQEAALWAIFENEAQKLHNREVNLY 129

  Fly   616 KMVDR--------------------------MIGMDLE------HSKC---------TLKKLAQW 639
            |:.::                          ::||:.:      |..|         .|:.:|..
 Worm   130 KITEKWNKNETMLSPKIYFYKKFDAENKTKGILGMEFDGNVTVRHIYCNVKPRELYPVLRSIATL 194

  Fly   640 HAAS-------------LKYKELNGPYSPKYNNGI--FTEQTAPIFKGMF---VNTKKSFIEEVS 686
            .|.|             |..|::.|  |...|.|:  |.|||..|.:...   .|..::|.:||.
 Worm   195 QAGSLHLTKDEIESISGLDVKQMMG--SLMNNEGMKGFYEQTREINRKRLTEKTNVVEAFGQEVV 257

  Fly   687 KFD---GVDEYLHKMPEILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMFQYESDGRVKETLL 748
            .|:   .:::|:.         :.|            :|:.|||.|..||:::.:.:|....:.:
 Worm   258 NFELACNLNKYIG---------IKR------------DVMVHGDLWAANILWKEKDEGTFSVSKV 301

  Fly   749 LDHQVTKYGNPAQDLYYFIMSS 770
            :|:|:...||||:||....:|:
 Worm   302 IDYQLIHMGNPAEDLVRLFLST 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 64/317 (20%)
F48G7.12NP_503277.2 DUF1679 10..421 CDD:369592 67/347 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.