DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and F20D6.5

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_505104.3 Gene:F20D6.5 / 184724 WormBaseID:WBGene00017635 Length:376 Species:Caenorhabditis elegans


Alignment Length:353 Identity:70/353 - (19%)
Similarity:132/353 - (37%) Gaps:113/353 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 GDNFASKLLKVEIEAQLKDNSVKTFSYILKVHSDNDAINFSDFNLFPKEIEVYSTYVPAFERFYK 581
            ||:...||...|::|         ::::.|         |||.|:             ::.:.|:
 Worm    65 GDDTFCKLHNTEVDA---------YTFLQK---------FSDKNI-------------SYPKIYE 98

  Fly   582 DVGLPVTFSPKSFRLSKDVSKEYLLLE------------NLQPSGFKMVDRMIGMDLEHSKCTLK 634
            ...:.::..|        :.:.::::|            ||:|      |.:|.        .:|
 Worm    99 LEKMDISVDP--------IKQGHIIMEYMSGITHLYCYNNLKP------DELIE--------PVK 141

  Fly   635 KLAQWHAASLKYKELNGPYSPK-----YNNGIFTEQTAPIFKGMFVNTKKSFI------EEVSKF 688
            .||::|:...:..|..|...|:     :...:||:|....|.|.:......::      :.:.:.
 Worm   142 NLARFHSIGAELDEEEGSNVPRDFLSSWFTTLFTQQNKNTFIGNWKGDLSDWLPSKVARDTIKEL 206

  Fly   689 DGVDEYLHKMPEILDTYVDRILEDAKINEQ-----AFNVLNHGDAWINNIMFQYESDGRVKETLL 748
            ||:     ..|||.          .|:|..     ...||.|||...:|::::...||..|...:
 Worm   207 DGL-----LTPEIF----------LKLNNDCQLTGVQEVLCHGDYSFHNLLYEKHCDGSYKFRAI 256

  Fly   749 LDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAK-----------LLNYNG 802
            :|.|...:||.||||....:::.....:.|..|.|::.|:..:.:.:|           ..:|..
 Worm   257 VDFQSVNWGNAAQDLSRLFVTAMSGKDRRDSEDRLLKIYYDELIKVSKGNVAPFTWEQLKQSYTR 321

  Fly   803 FIPSLKELHAILIQHPIFAAGTVLTTLS 830
            |.    :|||.::  .....|..|.|||
 Worm   322 FF----QLHAAIV--CTVTPGLFLVTLS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 60/321 (19%)
F20D6.5NP_505104.3 PKc_like 11..369 CDD:389743 70/353 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I7597
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12411
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.