DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and E02C12.10

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_505430.3 Gene:E02C12.10 / 183989 WormBaseID:WBGene00017095 Length:417 Species:Caenorhabditis elegans


Alignment Length:428 Identity:90/428 - (21%)
Similarity:153/428 - (35%) Gaps:145/428 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DVDQFSKI-VGFRVKPAMAPGENYATLMLRISIDVELTDKSTK---LVSFMMKVPHDTPQ---ME 119
            ||::..:| :|.:.|    .|||               .|||.   |..||.|:....|.   :|
 Worm    19 DVEEAMQISLGTKAK----FGEN---------------KKSTNISDLKGFMSKIAMIEPHWVGVE 64

  Fly   120 QMMSMANFFT---SENAAYTEILPKMEELYKAKGLDIKFAPRAFKLDATKEPKVANTVLMHDLGQ 181
            ....:.|.||   |...|:. :|.|..:.....|.|              |.|:..         
 Worm    65 NDKVLPNKFTVKISSQLAFA-VLSKTMKFGGVDGFD--------------EEKLKT--------- 105

  Fly   182 NGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVH--GPYPDIFVNGVMG------------ 232
              |.|:.| ||.|.|...:.:  |.:|:.:.....:|:  .|:.|  .|.:.|            
 Worm   106 --FGNVTR-ECHNREVAAYKM--LIKFNNSDIPFTKVYHLKPFDD--ANDLKGFMIMEFIPNVHS 163

  Fly   233 -NNKEAI-----IAFMEGMLASF----------RTSF------------MANLDKFKN------- 262
             ...|||     |:.:.| :|:|          :||.            :.::|:.:.       
 Worm   164 IPMYEAIPADDLISLVRG-IATFAALGETSEGDKTSAGGPEFIDMMFEEVLSMDQIEGHFDSLRI 227

  Fly   263 --GEEYREKLEKALAGL------TMEFMKLG------IVDPNEFNALNHGDCWMNNLLFKMNSSG 313
              |.|:...:|.::..|      |.::.|:.      :|       |||||.|.:|:|..::..|
 Worm   228 LYGSEHLNTVETSITILRQYRMITKKYTKISELLGFKLV-------LNHGDLWQSNMLHCLDEFG 285

  Fly   314 DLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFDFFIRHYQEALVKHLGILGFTGRKPS 378
            :|:....:|:|......|.:||...::..:....:.......::.|.|...:.||...|     |
 Worm   286 NLKLKAIIDWQGVSTLPPGLDLSRLLMGCLSAHERRERGLEMLKLYHETFNQVLGKELF-----S 345

  Fly   379 LRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSATFDN 416
            .:||..:...|     :|.:::|.|    |..|:..||
 Worm   346 FQELQDSYNLY-----YPMMAMLLL----PIVSSFLDN 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 73/363 (20%)
EcKinase 516..800 CDD:281023
E02C12.10NP_505430.3 DUF1679 3..408 CDD:369592 90/428 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.