DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and E02C12.6

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_505426.2 Gene:E02C12.6 / 183987 WormBaseID:WBGene00017092 Length:419 Species:Caenorhabditis elegans


Alignment Length:412 Identity:80/412 - (19%)
Similarity:161/412 - (39%) Gaps:87/412 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 PDWLNIDDFKE--IILSAEPNFEKILSSTSKLATKPGDN-FASKLLKVEIEAQLKDNSVKTFSYI 544
            |||.|::|.|:  :..:.:.:.:..|.:.||:....|.| |..:.||...:...|.::::..:| 
 Worm    58 PDWQNVEDGKKLPVRFALKISSQLALVALSKMLNFGGGNGFTEEKLKKFSKLTRKSHNIEVETY- 121

  Fly   545 LKVHSDNDAINFSDFNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLSKDVSKEYLLLEN 609
             ||        .:.||                   :.|:.....:|.|.|. .:|..|.||:.:.
 Worm   122 -KV--------LTKFN-------------------HPDIPYTKVYSLKPFN-GEDDLKGYLITDF 157

  Fly   610 LQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIFTEQTAPIFKGMF 674
            :  ....:::....:..::...|::.:|.:.|.:   :.|.......:.:..|.|.   :|:..|
 Worm   158 I--PNVHVIEAYKSIPADNIAATIRGIATFSALA---EHLEREEQKSFMSTDFLEL---LFEDFF 214

  Fly   675 VNTK--KSFIEEVSKFDGVD--EYLHKMPEILDTYVDRILEDAKINE--QAFNVLNHGDAWINNI 733
            .:.:  |.|....:||:|..  |.:.|:.::...|...:.:...|::  ....|..|||.|.:||
 Worm   215 TDAELSKKFEALKTKFEGQQHAEKVSKLIKVFAHYKALVKKYTNISDLLGLKPVFIHGDLWQSNI 279

  Fly   734 MFQYESDGRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLL 798
            ||..::..::|...::|.|......|..||...::.......:.::...|::.||:.   :||:.
 Worm   280 MFTLDNSKKLKLEAIIDWQSVSRIPPGIDLSRIMLGCLSAQERRERGTELLKLYHET---YAKVF 341

  Fly   799 ------------NYNGFIPSLKELHAILIQHPIFAAGTVLTTLSMCLNKTTDDFTTDSFLGNEEN 851
                        :||.:.|.:..|              :|.:||        .|...:.:..||.
 Worm   342 GKELFTFQELQDSYNLYAPMMAML--------------ILPSLS--------SFLDSAQISKEEK 384

  Fly   852 GKSLREAMFSNERYRANIERVM 873
            ..:..|.   |.:..|.||.::
 Worm   385 AAAAEEV---NLKEVAMIEDIL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 56/302 (19%)
E02C12.6NP_505426.2 DUF1679 3..410 CDD:369592 80/412 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.