DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and T16G1.7

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:NP_506233.1 Gene:T16G1.7 / 179774 WormBaseID:WBGene00011801 Length:436 Species:Caenorhabditis elegans


Alignment Length:364 Identity:77/364 - (21%)
Similarity:144/364 - (39%) Gaps:94/364 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 LNIDDFKEIILSAEPNFEKILSSTSK-LATKPGDNFASKLLKVEIEAQLKDNSVKTFSYILKVHS 549
            :.:||.:::| ..:.|.|..|...:| .....|:.|.|:::.||.|..:.|..:.. .:|||:.|
 Worm    22 VQLDDVQDVI-GEQMNTEARLGKNTKYTVVGDGNGFMSRVILVEPEWTVPDEHLPE-KFILKITS 84

  Fly   550 ---------------------DNDAINFSDF-----NLFPKEIEVYSTYVPAFERFYKDVGLPVT 588
                                 :.:|..::.|     .|..:|:.:|.    ..|::.|:   ...
 Worm    85 CLHVHGLVEKMKGKSPGAFPAEQEAALWAIFENEAQQLHNREVNLYK----ITEKWNKN---ETM 142

  Fly   589 FSPKSFRLSK-DVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKC---------TLKKLAQWHAAS 643
            .|||.:...| |.       || :..|...::.:..:.:.|..|         .|:.||...|.|
 Worm   143 LSPKIYFYKKFDA-------EN-KTKGILGMEFVSDVTIRHLYCNAKPYELHPVLRSLATLQAGS 199

  Fly   644 L-------------KYKELNGPYSPKYNNGIFTEQTAPIFKGMF---VNTKKSFIEEVSKFD--- 689
            |             .:|::.|....:.......|||..|.....   .||.::|..||..|:   
 Worm   200 LHLTEDEINSISGFDFKQMMGAMMNEEGMKNIYEQTREINPERLTEKTNTVEAFGLEVVNFELSC 264

  Fly   690 GVDEYLHKMPEILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMFQYESDGRVKETLLLDHQVT 754
            .:::|:.         ::|            :||.|||.|..||:::.|:||:...:.::|:|:.
 Worm   265 NLNKYVG---------IER------------DVLVHGDLWAANILWKEENDGKFSVSKVIDYQLI 308

  Fly   755 KYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKE 793
            ..||||:||....:|:.....:...::.|:..:::...|
 Worm   309 HMGNPAEDLVRVFLSTLSGADRQAHWERLLEQFYEYFLE 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 70/333 (21%)
T16G1.7NP_506233.1 DUF1679 10..423 CDD:369592 77/364 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.