DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and AgaP_AGAP003236

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_312943.4 Gene:AgaP_AGAP003236 / 1273909 VectorBaseID:AGAP003236 Length:441 Species:Anopheles gambiae


Alignment Length:315 Identity:77/315 - (24%)
Similarity:141/315 - (44%) Gaps:57/315 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 DNFASKLLKVEIEAQLKDNS-VKTFSYILKVHSDNDAINFSDF--NLFPKEIEVYSTYVPAFERF 579
            |.|.|.:.|:....:..|.: |:|...::||...:|....|..  ..|..||.:|:..:|||:..
Mosquito    43 DGFMSTIHKLSFRYESNDGTVVQTLKLMVKVMKGSDEFRESSMGKTQFTNEIYIYTKVLPAFQEL 107

  Fly   580 YKDVGLPVTFSPK-------SFRLSKDVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLA 637
            ..|.||...:.|:       .|....|..:..|:||::.|.|:|...| :.::.||.:...:.:|
Mosquito   108 LTDSGLAGDWCPRVYYGEAGHFPTYSDQYETILVLEDISPLGYKAGPR-LDLEEEHLRLMARHIA 171

  Fly   638 QWHAASLKYKELNGPYSPKYNNGIFTEQTAPIFKGM----FVNTKKSFIEEVSKFD-----GVD- 692
            .:||.:         |:.:..|   ..:.|.:.:|:    ||:..|:|    :.:|     |.: 
Mosquito   172 SFHACT---------YAMRLRN---DARLASLIEGIAPLDFVSGDKTF----TSYDVLLKLGANR 220

  Fly   693 --EYLHKMPEILDTYVDR----------------ILEDAKINEQAFNVLNHGDAWINNIMFQYES 739
              :||...||.||:...:                :::|....::.|:|:.|||...||::|:.:.
Mosquito   221 LYKYLDDHPEQLDSEAFKRDMNNLRQRYGTTPISLMQDLLRKDETFSVILHGDYNRNNVLFRADG 285

  Fly   740 DGRVKETLLLDHQVTKYGNPAQDL-YYFIMSSTQLDIKVDQFDYLIRWYHQNMKE 793
            .|:..|..:.|.|..:|..|..|| :|..||.|: :::...:|.::..||..:.|
Mosquito   286 AGKPVELKMFDFQENRYATPVIDLTFYMYMSMTE-ELRNRCWDAIVLEYHTALLE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 77/315 (24%)
AgaP_AGAP003236XP_312943.4 PKc_like 43..341 CDD:304357 77/315 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.