DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and AgaP_AGAP003220

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_003436421.1 Gene:AgaP_AGAP003220 / 1273895 VectorBaseID:AGAP003220 Length:426 Species:Anopheles gambiae


Alignment Length:459 Identity:103/459 - (22%)
Similarity:176/459 - (38%) Gaps:90/459 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SDLVPKWLNQTQFEELLAADVDQFSKIVGFRV-KPAMAPGENYATLMLRISIDVELTDKSTK--- 103
            ||:.||:..:|..|.:..|.   ..:..|::: :.....|:.|.:.:.||.:..|..:....   
Mosquito    11 SDISPKFTEETLDEIVRCAG---GKRCTGWKIPETNFTKGDAYLSELYRIQLTGEPAEPGRDEPL 72

  Fly   104 LVSFMMK-VPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAFK------ 161
            :|:.::| :|.:..:.....| |:||.:|...|..:|   :|||:.:  |.:.....||      
Mosquito    73 VVNVVVKTIPKNVGRRNTFRS-ADFFRNEANFYNVVL---KELYRFQ--DARKPANPFKDINPCY 131

  Fly   162 ---LDATKEPKVANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQV----- 218
               .|.     |.:.|.|.||||.|:|..:|.:.:.|......:..:|:|||....|.|.     
Mosquito   132 VAYTDG-----VNDFVAMEDLGQYGYKTASRDKGVELADCLRCICSMARFHALSFAMKQQEPEAF 191

  Fly   219 -------------------HGPYPDIFVNGVMGNNKEAIIAFMEGMLASFRTSFMANLDKFKNGE 264
                               |||    |:..::...|||:..........:..:|..:...|.|..
Mosquito   192 ERIVSQLEETYYSAALEPWHGP----FMQRIVTICKEALDIECTESPDRYTANFRRDAQAFLNSP 252

  Fly   265 EYREKLEKALAGLTMEFMKLGIVDPNEFNALNHGDCWMNNLLFKMNSSGDLEDMV-FVDFQNPKY 328
            .|         |:.:|...    ..|.:..:.|||||:.|.|.:       .|.| .:|||..:.
Mosquito   253 IY---------GMMVELAN----TRNRYAVITHGDCWLPNFLLR-------PDQVRMIDFQMVRC 297

  Fly   329 GSPAMDLLYFIISSVQIDYKLSHFDFFIRHYQEALVKHLGILGFTGRKPSL--RELHRTLIKYGG 391
            .||.:||:.|:........:.:|:|..:..|..|..:.|..|| |..:.:.  ..|...|.::|.
Mosquito   298 ASPVLDLVLFVYCCTDQALRDTHYDQLLSAYYHAFAELLAELG-TDPQATFPASVLAAELQQFGR 361

  Fly   392 WVLFPTISVLPLVLLDPTQSATFDNFMS------DSADGVSFRGSLYANKRCQEYIERILPWLDN 450
            :.....:..:||..||.:.....|....      |....|...|:.|..:|..:    :|....:
Mosquito   362 FGCGIAVESIPLAQLDESDVPDLDRLEGTEPVPLDQILTVRSIGTQYGRRRLVD----VLRHAYD 422

  Fly   451 RGFL 454
            ||:|
Mosquito   423 RGYL 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 76/329 (23%)
EcKinase 516..800 CDD:281023
AgaP_AGAP003220XP_003436421.1 EcKinase 46..340 CDD:281023 75/328 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.