DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and AgaP_AGAP003855

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_310414.7 Gene:AgaP_AGAP003855 / 1271592 VectorBaseID:AGAP003855 Length:428 Species:Anopheles gambiae


Alignment Length:424 Identity:123/424 - (29%)
Similarity:186/424 - (43%) Gaps:55/424 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LNQTQFEELLAADVDQFSKIVGFRVKPAMAP-GENYA-TLMLRISIDVELTDKSTK-LVSFMMKV 111
            |.|||:.|   .:|    ||..:.|:||.|. .:.|| :.|.||.|.....:..|: :::|:.|:
Mosquito    18 LIQTQYGE---TEV----KIKAYDVEPASADINDPYARSSMNRILIKYTSKENPTEAVITFVAKI 75

  Fly   112 PHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAFKLDATKEPKVANTVLM 176
            ......:.:....|:.|..|...|..:||.|..:....|..|:.||:......|.    ::.|::
Mosquito    76 KPTEGLLVEQFKKADVFEKEILMYKSVLPSMVTMIAKLGSVIELAPQLIYSSETP----SDLVVL 136

  Fly   177 HDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDIFVNGVM-GNNKEAIIA 240
            .||...|:...|:...|:.||:|.|:.:||.||||.|.|:..:|.....|..|.. ..:|:.:..
Mosquito   137 EDLTARGYSVENQTLGLSYEQSKMAVEKLAFFHAASAMMLSENGQAFPKFTKGTFHAEHKDKLSY 201

  Fly   241 F-----MEGMLASFRTSFMANLDKFKNGEEYREKLEKALAGLTMEFMKLGIVDPNEFNALNHGDC 300
            |     |.|.:|       |.||   ..:...:||.|..|....:.::....|...|..|||||.
Mosquito   202 FPDTIRMVGEMA-------AELD---ISQPMADKLLKLPAKALQKAIEAYESDFKGFKVLNHGDF 256

  Fly   301 WMNNLLFKMNSSGDLEDMVF---VDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFDFFIRHYQEA 362
            |.||:|||...: :|.|..|   |||||...|||.:||:||:.:|...:....|.|..:..|.|.
Mosquito   257 WTNNILFKYQGN-ELVDANFVRVVDFQNCVVGSPIIDLVYFLAASPAHEVLEKHRDELVYIYHET 320

  Fly   363 LVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLV--------------LLDPTQSAT 413
            ||..|..:|:....|||.||...|:|:|...:...::|.|.:              |..|.||..
Mosquito   321 LVLLLQKMGYMKSIPSLLELQVELLKHGSLQVIYALTVSPFMRTKDAHNTPPMQPTLHSPNQSTN 385

  Fly   414 FDNFMSDSADGVSFRGSLYANKRCQEYIERILPW 447
            ....:...|.      |:.|..:..|.: .:|.|
Mosquito   386 VKQVLRAHAP------SIVAQLKAYEMV-GLLDW 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 90/303 (30%)
EcKinase 516..800 CDD:281023
AgaP_AGAP003855XP_310414.7 PKc_like 44..330 CDD:304357 90/300 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.