DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and AgaP_AGAP013194

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_003436597.1 Gene:AgaP_AGAP013194 / 11175655 VectorBaseID:AGAP013194 Length:404 Species:Anopheles gambiae


Alignment Length:422 Identity:119/422 - (28%)
Similarity:207/422 - (49%) Gaps:48/422 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 WLNIDDFKEII---LSAE-------PNFEKILSSTSKLATKPGDNFASKLLKVEIEAQLKDNSVK 539
            |...:.||:.|   ||.|       .:|| :..:..|.|     .:.|.:.:|.||.:....:.|
Mosquito     6 WKTAEFFKDAIVRDLSLECTDSFTITSFE-VGKANEKTA-----GYMSNIYRVLIELKFDKGTAK 64

  Fly   540 --TFSYILKVHSDNDAINFSD-----FNLFPKEIEVYSTYVPAFERFYKDVGLPVTFSPKSFRLS 597
              :.|||:|..:|.   .|..     .::||||.|||...:|||||..::....|.|.||..:.:
Mosquito    65 PTSLSYIVKEKTDT---AFGSGLVELLSVFPKESEVYEKLLPAFERLVQNEEETVRFGPKVLKTT 126

  Fly   598 KDVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWHAASLKYKELNGPYSPKYNNGIF 662
            .: ....::||:|..|.|:|.::..|:.:...|..|:|||::||||:.|.|.||.:|..:..|:.
Mosquito   127 TN-PDTVIVLEDLSRSQFRMREKSFGLSVTDVKRILEKLAKFHAASVLYVEKNGAFSDLFAEGVI 190

  Fly   663 TEQTAPIFKGMFVNTKKSFIEEVSKFDGVDEYLHKMPEILDTYVDRILEDAKINEQAFNVLNHGD 727
            :|:|....:|.:.:...:|::.:...:...|||..:.:.....:....:..:::.....||||||
Mosquito   191 SERTIDALRGHYESLYSAFVQSLRDRNMAPEYLQPLIKFDGQLLRECCKAQQVHHSELKVLNHGD 255

  Fly   728 AWINNIMFQYESDGRVKETLLLDHQVTKYGNPAQD-LYYFIMSSTQLDIKVDQFDYLIRWYHQNM 791
            .|.||:||..|      :...||.|...||:||.| ||:|..|:|:|  ..|..:.|:::||:::
Mosquito   256 LWPNNVMFGTE------DLRFLDFQTASYGSPAADLLYFFATSATEL--MCDSLEELLQYYHEHL 312

  Fly   792 KEHAKLLNYNGFIPSLKEL------HAILIQHPIFAAGTVLTTLSMCLNKTTDDFTTDSFLGNEE 850
            .:..:.|.|...||...||      .::|:..|:..|      |::.::..|:....:.....:.
Mosquito   313 VKTLQQLQYCKSIPMYTELLDQMRRRSVLLLPPLSEA------LAITMSGLTEPSDMEMITSEQP 371

  Fly   851 NGKSLREAMFSNERYRANIERVMPWINRRGLL 882
            .|.:||:.:::|..|.|.|:|::|.:....||
Mosquito   372 EGVALRKLVYNNPAYVALIDRLLPKLYELRLL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 87/291 (30%)
AgaP_AGAP013194XP_003436597.1 PKc_like 44..321 CDD:304357 87/288 (30%)
APH <208..310 CDD:279908 33/109 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.