DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and AgaP_AGAP013267

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_003436326.1 Gene:AgaP_AGAP013267 / 11175475 VectorBaseID:AGAP013267 Length:433 Species:Anopheles gambiae


Alignment Length:398 Identity:100/398 - (25%)
Similarity:165/398 - (41%) Gaps:82/398 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GENYATLMLRISI-----DVE------LTDKSTKL-----------VSFMMKVPHDTPQMEQMMS 123
            |::|:..:.||.|     |:|      .|:.|.::           .|.:.||...|.....:.:
Mosquito    36 GDSYSGDVYRIVIAPGSRDIEDFENNNNTNSSNRMHGERPATLPKPFSVIAKVAPTTSLRRSLYN 100

  Fly   124 MANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAFKLDATKEPKVANT-------VLMHDLGQ 181
            .:..|..|...:..:||..|...:|:||      |..|..|.....:.:.       :|..||..
Mosquito   101 SSAHFQREKYVFDVVLPMFERFQQARGL------RTAKSFAHYPSVIVSECCEGFEYILQRDLMA 159

  Fly   182 NGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDIFVNGVMGNNKEAIIAFMEGML 246
            :|::|..|.|.|..|.....||.||||||....|.|   ..||.:.. ::...:|.|  |:..:.
Mosquito   160 HGYRNFPRTEPLAYEDVLLVLTHLAQFHAISFAMQQ---QAPDAYAQ-IVSELQETI--FVPPLH 218

  Fly   247 ASFRTSFMANLDKFKNGEEYR-EKLEK-------ALAGLTMEF------MKLGIVDPNEFNALNH 297
            :||       :|..:...:|. |.|::       |:|.....|      ..:..|...:...:.|
Mosquito   219 SSF-------VDFLQRKVDYAIETLQRNPAAGDGAVAERLCRFRDEYGQAMVDCVQNRDDTVICH 276

  Fly   298 GDCWMNNLLFK-MNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFDFFIRHYQE 361
            ||||::|:|:: ||:    :::.|:|:|..:..:||:||.|||......:.: ......:|.|..
Mosquito   277 GDCWISNILYRPMNA----KELKFLDWQVARCATPAIDLSYFIFCCTDSELR-ERLPELLRKYHS 336

  Fly   362 ALVKHLGILG-FTGRK--PSLR-ELH-RTLIKYG-GWVLFPTISV------LPLV--LLDPTQSA 412
            |||:.:..|| ..||:  |..| ::| :...::| |..|....|.      ||.|  .|:.|:..
Mosquito   337 ALVRRMDELGTVNGRELFPFERLQMHMKKYARFGFGMALMTLHSTCCVEKDLPNVSAALETTELV 401

  Fly   413 TFDNFMSD 420
            ..|....|
Mosquito   402 DIDELAKD 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 84/335 (25%)
EcKinase 516..800 CDD:281023
AgaP_AGAP013267XP_003436326.1 PKc_like 35..340 CDD:304357 81/327 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.