DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6830 and AgaP_AGAP013124

DIOPT Version :9

Sequence 1:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster
Sequence 2:XP_003435871.1 Gene:AgaP_AGAP013124 / 11175451 VectorBaseID:AGAP013124 Length:622 Species:Anopheles gambiae


Alignment Length:393 Identity:89/393 - (22%)
Similarity:171/393 - (43%) Gaps:58/393 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 LATKPGDNFASKLLKVEI-EAQLKDNSVKTFSYILKVHSDNDA--INFSDFNLFPKEIEVYSTYV 573
            :.:..||.|..::.|..: |.:.::      .|:.|:...|:|  ..|....:|.:|...|.:.:
Mosquito   243 VGSNKGDGFVGQMFKAFLQEGERRE------VYLCKIPPLNEARRQQFQSMTIFSRETLAYKSLL 301

  Fly   574 PAFERFYKDVGLPVT---FS-PKSFRLSKDVSKE--YLLLENLQPSGFKMVDRMIGMDLEHSKCT 632
            |....:.::.|:...   |: ||.:....|.:.|  .:::|:|:...::|.::::.::.||::.|
Mosquito   302 PLIFTYQEEKGISREDGFFNVPKCYYAECDETTEQSVIIMEDLRLKDYRMWNKLVPVNYEHARLT 366

  Fly   633 LKKLAQWHAASLKYK----------ELNGPYSPKYNNGIFTEQTAPIFKGMFV---NTKKSFIE- 683
            :::|.:.||.||..|          ::..|..      :...:.:| |:.|.:   ...|..:| 
Mosquito   367 MQQLGRLHAVSLAMKRDRPADFEQFKVPDPLE------VMMPEGSP-FEAMMIKMLTDAKETLEP 424

  Fly   684 -EVSKFDGVDEYLHKMPEILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMFQYESDGRVKETL 747
             |..:...:.:.:..|.:.:.|..|..|      .:.:.||.|||.|:||.||.|: :|..:..:
Mosquito   425 HETKERTKMQKLIDNMRQEMKTCTDGAL------AEPYAVLGHGDCWVNNFMFHYK-NGAPEHVI 482

  Fly   748 LLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLNYN--------GFI 804
            |||.|:|:|.:|..||.|||...|..:.:...:|.::..|:.:::...:.|.:|        ..:
Mosquito   483 LLDWQITRYVSPVTDLSYFIFCCTDGEFRRRHYDEMMSIYYNSLEALLEKLGHNPQEVFPRTALM 547

  Fly   805 PSLKELHAILIQHPIFAAGTVLTTLSMCLNKTTDDFTTDSFLGNEENGKSLREAMFSNERYRANI 869
            ..|:......|...||....:.|.     |:...|....:....|.|...| .||..|...||..
Mosquito   548 RQLRRFGRFGILMAIFLVPMLCTR-----NEDLPDMDEAAEKYRETNEMDL-NAMTLNANQRAYR 606

  Fly   870 ERV 872
            ||:
Mosquito   607 ERM 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 71/307 (23%)
AgaP_AGAP013124XP_003435871.1 EcKinase 247..535 CDD:281023 71/307 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.