DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ho and hmox1a

DIOPT Version :9

Sequence 1:NP_524321.1 Gene:Ho / 41407 FlyBaseID:FBgn0037933 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001120988.1 Gene:hmox1a / 791518 ZFINID:ZDB-GENE-030131-3102 Length:272 Species:Danio rerio


Alignment Length:225 Identity:56/225 - (24%)
Similarity:96/225 - (42%) Gaps:42/225 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DSQVSENVEDVEFVDMAFTKELRKATKDVHNLTDVLVNAKIALALSDDEV---WYDGLL-AFYEL 70
            ||..|:..|:   .....:::::..|||.|...:   |.::.|:....::   .|..|| :.||:
Zfish     2 DSTKSKAAEN---TGSDLSEQIKAVTKDSHVRAE---NTQLMLSYQKGQITQTQYKLLLCSLYEI 60

  Fly    71 YKFFETHLPER---------LLPKEFHRTAAFERDFAYFYGSDWRKDYEIRPAVQKYLEHLEKIA 126
            |:..|..|...         ..|:|..|..|..:|..:|:|..|||...:..|..:|.:.|.:|.
Zfish    61 YRALEEELDRNADHPAVQPIYFPQELARLEALGQDLEHFFGPQWRKRITVPAATHRYAQRLREIG 125

  Fly   127 AQNELLLFAYSYQMYMALMSGGQMLQK-----KRMIARKMWIF-----------------SKNDD 169
            ..:..||.|::|..|:..:||||:|.|     ..:...|..:|                 |:.:.
Zfish   126 KSSPELLVAHAYTRYLGDLSGGQVLGKITQKSLGLTGNKGILFFSFPGVTSANRFKQLYRSRMNS 190

  Fly   170 EEQQKQADKEAELATARAADGSVDK-DDLE 198
            .|..:|..:||.....||.:.::|. |||:
Zfish   191 IEFTEQKRQEALDEAVRAFEFNIDVFDDLQ 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HoNP_524321.1 Heme_oxygenase 25..265 CDD:279470 52/210 (25%)
hmox1aNP_001120988.1 Heme_oxygenase 14..218 CDD:279470 49/206 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596039
Domainoid 1 1.000 72 1.000 Domainoid score I9281
eggNOG 1 0.900 - - E1_COG5398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424194at2759
OrthoFinder 1 1.000 - - FOG0002659
OrthoInspector 1 1.000 - - otm24336
orthoMCL 1 0.900 - - OOG6_104451
Panther 1 1.100 - - LDO PTHR10720
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2150
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.740

Return to query results.
Submit another query.