DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ho and hmox2

DIOPT Version :9

Sequence 1:NP_524321.1 Gene:Ho / 41407 FlyBaseID:FBgn0037933 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001072640.1 Gene:hmox2 / 780096 XenbaseID:XB-GENE-948111 Length:307 Species:Xenopus tropicalis


Alignment Length:268 Identity:54/268 - (20%)
Similarity:95/268 - (35%) Gaps:87/268 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LRKATKDVHNLTDVLVNAKIALALSDDEVWYD----GLLAFYELYKFFETHLPER---------- 81
            |::.||:.||..:   |.|.........:..:    ...|.|..|...|..| ||          
 Frog    31 LKEGTKESHNRAE---NTKFVRDFLKGRIQRETFKLATAALYFTYSALEEEL-ERNKEEPAIVPL 91

  Fly    82 LLPKEFHRTAAFERDFAYFYGSDWRKDYEIRPAVQKYLEHLEKIAAQNELLLFAYSYQMYMALMS 146
            ..|:|.||..|.|||..||||..|.:..:...|.:.|:..:..:......||.|::|..||..:|
 Frog    92 YFPQELHRKEALERDLCYFYGDAWAEAIQCSGATEAYVRRIRHLGRTRPELLVAHAYTRYMGDLS 156

  Fly   147 GGQMLQKKRMIARK------------MWIFSKNDDEEQQKQADKEAELATARAADGSVDKDDLEA 199
            |||:|:|   :|::            .::|....:.:|.||                        
 Frog   157 GGQILRK---VAQRALHLPPTGEGIQFYVFDNVTNAQQFKQ------------------------ 194

  Fly   200 RPMPAQVTICPPGCEATYFPEKISVLKAKLRRVFNNHYGAFDDDLRAAFIEESRNVFRLNIEVVR 264
                                    :.:|:|..:      ..|.:.:.:.::|:.:.|:.|::|..
 Frog   195 ------------------------LYRARLNAL------DLDPETKESVVQEANHAFQFNMQVFE 229

  Fly   265 TIKGVNRA 272
            .:..:..|
 Frog   230 ELDKIGTA 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HoNP_524321.1 Heme_oxygenase 25..265 CDD:279470 53/259 (20%)
hmox2NP_001072640.1 Heme_oxygenase 26..230 CDD:366479 53/259 (20%)
kinked helix 141..168 CDD:350856 13/29 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10289
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5205
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002659
OrthoInspector 1 1.000 - - otm48925
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.