DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ho and HMOX1

DIOPT Version :9

Sequence 1:NP_524321.1 Gene:Ho / 41407 FlyBaseID:FBgn0037933 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_002124.1 Gene:HMOX1 / 3162 HGNCID:5013 Length:288 Species:Homo sapiens


Alignment Length:256 Identity:62/256 - (24%)
Similarity:109/256 - (42%) Gaps:67/256 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TKELRKATKDVHNLTDVLVNAKIALALSDDEVWYDG----LLAFYELYKFFETHLPER------- 81
            ::.|::|||:||...:   ||:........:|..||    :.:.|.:|...|..: ||       
Human    14 SEALKEATKEVHTQAE---NAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEI-ERNKESPVF 74

  Fly    82 ---LLPKEFHRTAAFERDFAYFYGSDWRKDYEIRPAVQKYLEHLEKIAAQNELLLFAYSYQMYMA 143
               ..|:|.||.||.|:|.|::||..|::.....||:|:|::.|.::......||.|::|..|:.
Human    75 APVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLG 139

  Fly   144 LMSGGQMLQKKRMIARKMWIFSKNDDEEQQKQADKEAELATARAADGSVDKDDLEARPMPAQVTI 208
            .:||||:|:|   ||:|                                      |..:|:.   
Human   140 DLSGGQVLKK---IAQK--------------------------------------ALDLPSS--- 160

  Fly   209 CPPGCEATYFPEKISVLKAKLRRVFNNHYGAFD--DDLRAAFIEESRNVFRLNIEVVRTIK 267
             ..|.....||...|.  .|.::::.:...:.:  ..:|...|||::..|.|||::...::
Human   161 -GEGLAFFTFPNIASA--TKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HoNP_524321.1 Heme_oxygenase 25..265 CDD:279470 62/252 (25%)
HMOX1NP_002124.1 Heme_oxygenase 11..216 CDD:395895 62/252 (25%)
kinked helix 127..154 CDD:350855 14/67 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 223..260
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159802
Domainoid 1 1.000 74 1.000 Domainoid score I9158
eggNOG 1 0.900 - - E1_COG5398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5340
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424194at2759
OrthoFinder 1 1.000 - - FOG0002659
OrthoInspector 1 1.000 - - otm41705
orthoMCL 1 0.900 - - OOG6_104451
Panther 1 1.100 - - LDO PTHR10720
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2150
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.