DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ho and Hmox1

DIOPT Version :9

Sequence 1:NP_524321.1 Gene:Ho / 41407 FlyBaseID:FBgn0037933 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_034572.1 Gene:Hmox1 / 15368 MGIID:96163 Length:289 Species:Mus musculus


Alignment Length:282 Identity:65/282 - (23%)
Similarity:115/282 - (40%) Gaps:78/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TKELRKATKDVHNLTDVLVNAKIALALSDDEVWYDG----LLAFYELYKFFETHLPER------- 81
            ::.|::|||:||...:   ||:........:|..:|    :.:.|.:|...|..: ||       
Mouse    14 SEALKEATKEVHIQAE---NAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEI-ERNKQNPVY 74

  Fly    82 ---LLPKEFHRTAAFERDFAYFYGSDWRKDYEIRPAVQKYLEHLEKIAAQNELLLFAYSYQMYMA 143
               ..|:|.||.||.|:|.|::||..|::.....||.|.|::.|.::...:..||.|::|..|:.
Mouse    75 APLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLG 139

  Fly   144 LMSGGQMLQKKRMIARKMWIFSKNDDEEQQKQADKEAELATARAADGSVDKDDLEARPMPAQVTI 208
            .:||||:|:|   ||:|                      |.|..:.|.                 
Mouse   140 DLSGGQVLKK---IAQK----------------------AMALPSSGE----------------- 162

  Fly   209 CPPGCEATYFPEKISVLKAKLRRVFNNHYGAFD--DDLRAAFIEESRNVFRLNIEVVRTIKGV-- 269
               |.....||...|  ..|.::::.......:  .:::....||::..|.||||:...::.:  
Mouse   163 ---GLAFFTFPNIDS--PTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLT 222

  Fly   270 ---------NRANLRKLALALI 282
                     ..|:||:...:|:
Mouse   223 EEHKDQSPSQMASLRQRPASLV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HoNP_524321.1 Heme_oxygenase 25..265 CDD:279470 61/252 (24%)
Hmox1NP_034572.1 Heme_oxygenase 11..216 CDD:279470 61/252 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 224..262 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850172
Domainoid 1 1.000 71 1.000 Domainoid score I9422
eggNOG 1 0.900 - - E1_COG5398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5316
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002659
OrthoInspector 1 1.000 - - otm43755
orthoMCL 1 0.900 - - OOG6_104451
Panther 1 1.100 - - LDO PTHR10720
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2150
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.