DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ho and cdkl4

DIOPT Version :10

Sequence 1:NP_524321.1 Gene:Ho / 41407 FlyBaseID:FBgn0037933 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_031748765.1 Gene:cdkl4 / 100488143 XenbaseID:XB-GENE-13579892 Length:342 Species:Xenopus tropicalis


Alignment Length:75 Identity:18/75 - (24%)
Similarity:28/75 - (37%) Gaps:19/75 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 KLRRVFNNHYG-AFDDDLRAA--------FIEES-----RNVFRLNIEVVRTIKGVNRANL---- 274
            ||.::....|| .|....|..        |:|..     :.:....|.:::.:|..|..||    
 Frog     6 KLAKIGEGSYGVVFKCRSRETGQVVAIKKFVESEDDPVIKKIALREIRMLKQLKHNNLVNLLEVF 70

  Fly   275 -RKLALALIF 283
             ||..|.|:|
 Frog    71 RRKRKLHLVF 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HoNP_524321.1 Heme_oxygenase 25..265 CDD:395895 9/50 (18%)
kinked helix 131..160 CDD:350856
cdkl4XP_031748765.1 STKc_CDKL1_4 2..289 CDD:270837 18/75 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.