DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ho and hmox2b

DIOPT Version :9

Sequence 1:NP_524321.1 Gene:Ho / 41407 FlyBaseID:FBgn0037933 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_002661145.1 Gene:hmox2b / 100329531 ZFINID:ZDB-GENE-091118-52 Length:318 Species:Danio rerio


Alignment Length:272 Identity:64/272 - (23%)
Similarity:100/272 - (36%) Gaps:84/272 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QVSENVEDVEFVDMAFTKELRKATKDVHNLTDVLVNAKIALALSDDEVWYDGLLAFYELYKFFET 76
            :|.:..|:.|||.......:||                        |::..|.:|.|..|...|.
Zfish    47 EVHQKAENTEFVKDFLRGRIRK------------------------ELFKLGHVALYFTYSALEE 87

  Fly    77 HLPER----------LLPKEFHRTAAFERDFAYFYGSDWRKDYEIRPAVQKYLEHLEKIAAQNEL 131
            .: ||          ..|.|.||..|..:|..:||||||:....|.||.|:|::.:.:|......
Zfish    88 EI-ERNKDHPQFAPLYFPHELHRRDALAQDLQFFYGSDWQTQISISPATQRYVQRIHQIGKDEPA 151

  Fly   132 LLFAYSYQMYMALMSGGQMLQKKRMIARKMWIFSKNDDEEQQKQADKEAELATARAADGSVDKDD 196
            ||.|::|..||..:||||:|:|....|.|:                         .|.|    |.
Zfish   152 LLVAHAYTRYMGDLSGGQVLRKVAQRALKL-------------------------PASG----DG 187

  Fly   197 LEARPMPAQVTICPPGCEATYFPEKISVLKAKLRRVFNNHYGAFD--DDLRAAFIEESRNVFRLN 259
            |.                 .|..:.:|..|| .::::.:.....:  .|.:...:||:...|:.|
Zfish   188 LN-----------------FYMFDNVSNAKA-FKQLYRSRMNELELQQDTKLKIVEEAVLAFQFN 234

  Fly   260 IEVVRTIKGVNR 271
            ||:...|..|.:
Zfish   235 IEIFEEIGEVGQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HoNP_524321.1 Heme_oxygenase 25..265 CDD:279470 57/251 (23%)
hmox2bXP_002661145.1 Heme_oxygenase 35..240 CDD:307329 62/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596040
Domainoid 1 1.000 72 1.000 Domainoid score I9281
eggNOG 1 0.900 - - E1_COG5398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424194at2759
OrthoFinder 1 1.000 - - FOG0002659
OrthoInspector 1 1.000 - - otm24336
orthoMCL 1 0.900 - - OOG6_104451
Panther 1 1.100 - - O PTHR10720
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.710

Return to query results.
Submit another query.