DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ho and hmox2a

DIOPT Version :9

Sequence 1:NP_524321.1 Gene:Ho / 41407 FlyBaseID:FBgn0037933 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001096609.1 Gene:hmox2a / 100002875 ZFINID:ZDB-GENE-040914-13 Length:310 Species:Danio rerio


Alignment Length:291 Identity:67/291 - (23%)
Similarity:110/291 - (37%) Gaps:84/291 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ADSQVS---ENV-----------EDVEFVDMAFTKELRKATKDVHNLTDVLVNAKIALALSDDEV 59
            |||.||   ||:           .|:..|..|.|||.....::...:.|.| ..:|     ..|:
Zfish     3 ADSAVSNGGENILTDSDDDILNPNDLSEVLAAGTKESHDKAENSPFVKDFL-RGRI-----KREL 61

  Fly    60 WYDGLLAFYELYKFFETHLPERL----------LPKEFHRTAAFERDFAYFYGSDWRKDYEIRPA 114
            :..|..|.|.:|...|..: |::          .|.|.||..|..:|.|||||.||........|
Zfish    62 FKLGTTALYYVYSAIEEEI-EKVKDHAVFAPLYFPSELHRQEALAKDLAYFYGEDWESQISCSAA 125

  Fly   115 VQKYLEHLEKIAAQNELLLFAYSYQMYMALMSGGQMLQKKRMIARKMWIFSKNDDEEQQKQADKE 179
            .|.|::.:.::...:.:||.|:::..||..:||||:|:|....|.|:                  
Zfish   126 TQPYVDRIHEVGRDDPVLLVAHAWTRYMGDLSGGQILKKVAQRALKL------------------ 172

  Fly   180 AELATARAADGSVDKDDLEARPMPAQVTICPPGCEAT--YFPEKISVLKAKLRRVFNNHYGAF-- 240
                                          ||..|..  |..|.|....| .:|::.:.....  
Zfish   173 ------------------------------PPTGEGLNFYHFEGIHNPTA-FKRLYRSRMNELEV 206

  Fly   241 DDDLRAAFIEESRNVFRLNIEVVRTIKGVNR 271
            |.:.:|..::|:...|:||::|...::.:.:
Zfish   207 DAETKAKLLDEANLAFKLNLDVFTELQEIGK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HoNP_524321.1 Heme_oxygenase 25..265 CDD:279470 58/253 (23%)
hmox2aNP_001096609.1 Heme_oxygenase 26..231 CDD:279470 60/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596041
Domainoid 1 1.000 72 1.000 Domainoid score I9281
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424194at2759
OrthoFinder 1 1.000 - - FOG0002659
OrthoInspector 1 1.000 - - otm24336
orthoMCL 1 0.900 - - OOG6_104451
Panther 1 1.100 - - O PTHR10720
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2150
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.