DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf12 and TAF12

DIOPT Version :9

Sequence 1:NP_524320.1 Gene:Taf12 / 41406 FlyBaseID:FBgn0011290 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_010429.1 Gene:TAF12 / 851723 SGDID:S000002552 Length:539 Species:Saccharomyces cerevisiae


Alignment Length:187 Identity:62/187 - (33%)
Similarity:95/187 - (50%) Gaps:33/187 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HNSTSSASGLLHDPPMASPSQHSPMTNNSNSSSQNGGPVSGLGTGTGPISGGSKSSNHTSSAAGS 86
            :|.:||.|.:......|.|.       :.|.|::...||: ..:....|:|||..:      |.:
Yeast   345 NNISSSKSAIFKQTEPAIPI-------SENISTKTPAPVA-YRSNRPTITGGSAMN------ASA 395

  Fly    87 ENTP--------------MLTKPRLTELVREV-----DTTTQLDEDVEELLLQIIDDFVEDTVKS 132
            .|||              :::|.:|.|||:.|     |..|.:|.|||||||.:.||||.:....
Yeast   396 LNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAF 460

  Fly   133 TSAFAKHRKSNKIEVRDVQLHFERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALI 189
            :...||||||:.:|.||:|||.||.:|:.|||:..||:|..::...::.:.|:|..|
Yeast   461 SCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQSI 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf12NP_524320.1 TFIID_20kDa 93..159 CDD:112650 34/70 (49%)
TAF12NP_010429.1 COG5624 1..539 CDD:227911 62/187 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346837
Domainoid 1 1.000 67 1.000 Domainoid score I2357
eggNOG 1 0.900 - - E1_COG5624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004324
OrthoInspector 1 1.000 - - oto100321
orthoMCL 1 0.900 - - OOG6_103171
Panther 1 1.100 - - LDO PTHR12264
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1470
SonicParanoid 1 1.000 - - X4107
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.