DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf12 and EER4

DIOPT Version :9

Sequence 1:NP_524320.1 Gene:Taf12 / 41406 FlyBaseID:FBgn0011290 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_564023.1 Gene:EER4 / 838316 AraportID:AT1G17440 Length:683 Species:Arabidopsis thaliana


Alignment Length:193 Identity:56/193 - (29%)
Similarity:97/193 - (50%) Gaps:11/193 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GVAEHHLHHNHNSTSSASGLLHDPPMASPSQHSPMTNNSNSSSQNGGP--VSGLGTGTGPISGGS 74
            |.::.:..|:..........|...|.....|..........:.|...|  :|..|..:..::|..
plant   438 GQSQMNQSHSQQQLQQMQQQLQQQPQQQMQQQQQQQQQMQINQQQPSPRMLSHAGQKSVSLTGSQ 502

  Fly    75 KSSNHT-------SSAAGSENT-PMLTKPRLTELVREVDTTTQLDEDVEELLLQIIDDFVEDTVK 131
            ..:..:       ||:.|:|.| .:|.|.::.:||.:||...:||.|||:|||::.|||::....
plant   503 PEATQSGTTTPGGSSSQGTEATNQLLGKRKIQDLVSQVDVHAKLDPDVEDLLLEVADDFIDSVTS 567

  Fly   132 STSAFAKHRKSNKIEVRDVQLHFERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIK 194
            ...:.||||||:.:|.:|:.||.|:..::.||||.:::.|..| ...|:.||:|||::|..::
plant   568 FACSLAKHRKSSVLEPKDILLHLEKNLHLTIPGFSSEDKRQTK-TVPTDLHKKRLAMVRALLE 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf12NP_524320.1 TFIID_20kDa 93..159 CDD:112650 27/65 (42%)
EER4NP_564023.1 PABP-1234 <227..350 CDD:130689
TAF12 528..593 CDD:381751 28/64 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3666
eggNOG 1 0.900 - - E1_COG5624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004324
OrthoInspector 1 1.000 - - otm3232
orthoMCL 1 0.900 - - OOG6_103171
Panther 1 1.100 - - O PTHR12264
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.770

Return to query results.
Submit another query.