DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf12 and TAF12

DIOPT Version :9

Sequence 1:NP_524320.1 Gene:Taf12 / 41406 FlyBaseID:FBgn0011290 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_566367.1 Gene:TAF12 / 820168 AraportID:AT3G10070 Length:539 Species:Arabidopsis thaliana


Alignment Length:207 Identity:64/207 - (30%)
Similarity:102/207 - (49%) Gaps:45/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 HLHHNHNSTSSA--------SGLLHDP------------PMASPSQHSPMTNNSNSSSQNGGPVS 61
            |:...|.|||:|        |...|.|            |:|.|  |.|..            |.
plant   310 HIPQQHISTSAATPQPQQQQSQQQHQPQEQLQQLRSPQQPLAHP--HQPTR------------VQ 360

  Fly    62 GLGTG--TGPISGG----SKSSNHTSSAAGSENTP----MLTKPRLTELVREVDTTTQLDEDVEE 116
            ||...  |.|:...    ::..||..:.: :|..|    :|.|..:.||::::|.:.:||.:||:
plant   361 GLVNQKVTSPVMPSQPPVAQPGNHAKTVS-AETEPSDDRILGKRSIHELLQQIDPSEKLDPEVED 424

  Fly   117 LLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKYNMWIPGFGTDELRPYKRAAVTEA 181
            :|..|.:||||.......:.||||||:.:|.:|:.||.||.:|:..|||.:||.:.:::...|:.
plant   425 ILSDIAEDFVESITTFGCSLAKHRKSDILEAKDILLHVERNWNIRPPGFSSDEFKTFRKPLTTDI 489

  Fly   182 HKQRLALIRKTI 193
            ||:|||.|:|::
plant   490 HKERLAAIKKSV 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf12NP_524320.1 TFIID_20kDa 93..159 CDD:112650 26/65 (40%)
TAF12NP_566367.1 PABP-1234 <163..286 CDD:130689
TAF12 400..468 CDD:381751 27/67 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3666
eggNOG 1 0.900 - - E1_COG5624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004324
OrthoInspector 1 1.000 - - otm3232
orthoMCL 1 0.900 - - OOG6_103171
Panther 1 1.100 - - LDO PTHR12264
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4107
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.