DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf12 and TAF12

DIOPT Version :9

Sequence 1:NP_524320.1 Gene:Taf12 / 41406 FlyBaseID:FBgn0011290 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_016857675.1 Gene:TAF12 / 6883 HGNCID:11545 Length:241 Species:Homo sapiens


Alignment Length:155 Identity:85/155 - (54%)
Similarity:104/155 - (67%) Gaps:3/155 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SPMTNNSNSSSQNGGPVSGLGTGTGPISGGSKSSNHTSSAAG---SENTPMLTKPRLTELVREVD 105
            |.:.|.||.||....|.|....|:...|........|..|.|   .||..:|||.:|.:||||||
Human    87 SALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVD 151

  Fly   106 TTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKYNMWIPGFGTDEL 170
            ...||||||||:||||.|||:|..|.:....|:||||:.:||:|||||.||::||||||||::|:
Human   152 PNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEI 216

  Fly   171 RPYKRAAVTEAHKQRLALIRKTIKK 195
            ||||:|..|||||||:||||||.||
Human   217 RPYKKACTTEAHKQRMALIRKTTKK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf12NP_524320.1 TFIID_20kDa 93..159 CDD:112650 40/65 (62%)
TAF12XP_016857675.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160524
Domainoid 1 1.000 89 1.000 Domainoid score I7876
eggNOG 1 0.900 - - E1_COG5624
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68477
Inparanoid 1 1.050 159 1.000 Inparanoid score I4270
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1569957at2759
OrthoFinder 1 1.000 - - FOG0004324
OrthoInspector 1 1.000 - - oto91674
orthoMCL 1 0.900 - - OOG6_103171
Panther 1 1.100 - - LDO PTHR12264
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1470
SonicParanoid 1 1.000 - - X4107
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.