DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf12 and Taf12

DIOPT Version :9

Sequence 1:NP_524320.1 Gene:Taf12 / 41406 FlyBaseID:FBgn0011290 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_036020207.1 Gene:Taf12 / 66464 MGIID:1913714 Length:213 Species:Mus musculus


Alignment Length:175 Identity:89/175 - (50%)
Similarity:113/175 - (64%) Gaps:24/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NHNSTSSASGLLHDPPMASPSQHSPMTNNSNSSSQNGGPVSGLGTGTGPISGGSKSSNHTSSAAG 85
            |.:|.||    :...|.::|.|.| |.|::......|.|    ||| |.:|              
Mouse    63 NLSSFSS----VKPEPASTPPQGS-MANSTTVGKIAGTP----GTG-GRLS-------------- 103

  Fly    86 SENTPMLTKPRLTELVREVDTTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDV 150
            .||..:|||.:|.:||||||...||||||||:||||.|||:|..|.:....|:||||:.:||:||
Mouse   104 PENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDV 168

  Fly   151 QLHFERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIKK 195
            |||.||::||||||||::|:||||:|..|||||||:||||||.||
Mouse   169 QLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf12NP_524320.1 TFIID_20kDa 93..159 CDD:112650 40/65 (62%)
Taf12XP_036020207.1 TAF12 110..178 CDD:381751 31/67 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850872
Domainoid 1 1.000 89 1.000 Domainoid score I7866
eggNOG 1 0.900 - - E1_COG5624
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68477
Inparanoid 1 1.050 157 1.000 Inparanoid score I4265
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004324
OrthoInspector 1 1.000 - - oto95255
orthoMCL 1 0.900 - - OOG6_103171
Panther 1 1.100 - - LDO PTHR12264
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1470
SonicParanoid 1 1.000 - - X4107
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.