DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf12 and taf12

DIOPT Version :9

Sequence 1:NP_524320.1 Gene:Taf12 / 41406 FlyBaseID:FBgn0011290 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_012812390.1 Gene:taf12 / 548922 XenbaseID:XB-GENE-943294 Length:218 Species:Xenopus tropicalis


Alignment Length:172 Identity:85/172 - (49%)
Similarity:112/172 - (65%) Gaps:15/172 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ASGLLHDPPMASPSQHSPMTNNSNSSSQNGGPVSGLGTGTG----PISGGSKSSNHTSSAAGSEN 88
            ||.|::   ::|.|..:..|....|.:....||....|..|    |.:||.::|        .:.
 Frog    58 ASALIN---LSSFSSSTTTTTTPTSVAVKQEPVMANSTPVGKVPVPTAGGGRAS--------PDA 111

  Fly    89 TPMLTKPRLTELVREVDTTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLH 153
            ..:|||.:|.:||||||...||||||||:||||.|||:|..|.:....|:|||||.:||:|||||
 Frog   112 NQVLTKKKLHDLVREVDPNEQLDEDVEEMLLQIADDFIESVVSAACQLARHRKSNTLEVKDVQLH 176

  Fly   154 FERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIKK 195
            .||::||||||||::|:||||:|..|||||||:|||:||.||
 Frog   177 LERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIKKTQKK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf12NP_524320.1 TFIID_20kDa 93..159 CDD:112650 41/65 (63%)
taf12XP_012812390.1 TAF12 114..185 CDD:173964 44/70 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7637
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68477
Inparanoid 1 1.050 156 1.000 Inparanoid score I4200
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1569957at2759
OrthoFinder 1 1.000 - - FOG0004324
OrthoInspector 1 1.000 - - oto105441
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1470
SonicParanoid 1 1.000 - - X4107
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.