DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf12 and taf12

DIOPT Version :9

Sequence 1:NP_524320.1 Gene:Taf12 / 41406 FlyBaseID:FBgn0011290 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_938182.1 Gene:taf12 / 386637 ZFINID:ZDB-GENE-031030-5 Length:162 Species:Danio rerio


Alignment Length:167 Identity:82/167 - (49%)
Similarity:108/167 - (64%) Gaps:18/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SQHSPMTNNSNSSSQNGGPVSGLGTGTGPISGGSKSSNHTSSAAGSENTP------------MLT 93
            :|:...|:.||..:    .|....:.|.|:|  |..:|.|.:......||            :|:
Zfish     2 TQYPAQTSRSNFYT----VVKAEASSTPPLS--SSMANSTVAPGKLPGTPGPAGRLSPEGPQVLS 60

  Fly    94 KPRLTELVREVDTTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKY 158
            |.:|.:||||:|...||||||||:||||.|||:|..|.:....|:||||:.:||:|||||.||::
Zfish    61 KKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQW 125

  Fly   159 NMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIKK 195
            ||||||||:||:||||:|..|||||||:||||||.||
Zfish   126 NMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTTKK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf12NP_524320.1 TFIID_20kDa 93..159 CDD:112650 38/65 (58%)
taf12NP_938182.1 TAF12 58..129 CDD:173964 41/70 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596924
Domainoid 1 1.000 87 1.000 Domainoid score I8004
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68477
Inparanoid 1 1.050 152 1.000 Inparanoid score I4321
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1569957at2759
OrthoFinder 1 1.000 - - FOG0004324
OrthoInspector 1 1.000 - - oto41683
orthoMCL 1 0.900 - - OOG6_103171
Panther 1 1.100 - - LDO PTHR12264
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1470
SonicParanoid 1 1.000 - - X4107
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.