DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf12 and Taf12L

DIOPT Version :9

Sequence 1:NP_524320.1 Gene:Taf12 / 41406 FlyBaseID:FBgn0011290 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_608852.1 Gene:Taf12L / 33672 FlyBaseID:FBgn0031623 Length:138 Species:Drosophila melanogaster


Alignment Length:116 Identity:30/116 - (25%)
Similarity:59/116 - (50%) Gaps:2/116 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NNSNSSSQNGGPVSGLGTGTGPISGGSKSSNHTSSAAGSENTPMLTKPRLTELVREVDTTTQLDE 112
            |.|:||:::....|.....|..:.....|...:.|..|. :..:::|..:.:.|:::|..:.||:
  Fly    23 NESHSSTRSSSRSSDTSIDTSSVEKEPASVIESQSVPGG-SYDIISKTNMLQFVQKIDANSSLDD 86

  Fly   113 DVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKYNMWIP 163
            ...:::.:|.|.||.|........||:|||: :.|.|::...:|::||..|
  Fly    87 QGCDMMARIADAFVNDISMRIVKLAKYRKSD-VSVLDLKFILKREFNMEFP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf12NP_524320.1 TFIID_20kDa 93..159 CDD:112650 18/65 (28%)
Taf12LNP_608852.1 TFIID_20kDa 67..133 CDD:367691 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.