DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf12 and taf12

DIOPT Version :10

Sequence 1:NP_524320.1 Gene:Taf12 / 41406 FlyBaseID:FBgn0011290 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_594289.1 Gene:taf12 / 2542785 PomBaseID:SPAC15A10.02 Length:450 Species:Schizosaccharomyces pombe


Alignment Length:190 Identity:55/190 - (28%)
Similarity:100/190 - (52%) Gaps:25/190 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 STSSASGLLHD-----PPMASPSQHSPMTNNSNSSSQNGGPVS-GLGTGTGPISGGSKSSNHTSS 82
            |.:..|||.::     .|....:.|.|..::.:       |:. .:......::||..|.:...|
pombe   267 SATQQSGLANNVEKSQTPSYMSANHLPKVDSKS-------PIPFSVPPSRATLTGGYASGSIGLS 324

  Fly    83 AAGSENTP---------MLTKPRLTELVREVDTTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAK 138
            ..|....|         :|:|.:|.:|::::|:..:::.:||||||:|.|:|||.........||
pombe   325 TPGLSRAPHYELDNGNRLLSKRKLHDLLQQIDSEEKIEPEVEELLLEIADEFVESVTNFACRLAK 389

  Fly   139 HRKSNKIEVRDVQLHFERKYNMWIPGFGTDEL-RPYKRAAVTEAHKQRLALI--RKTIKK 195
            ||||:.::|||||||.||.:|:.:|||.:|:: :..::...|.:::|:...|  .|::.|
pombe   390 HRKSDTLDVRDVQLHLERNWNIRLPGFASDDIVKSARKTGPTPSYQQKQNAIGTAKSLNK 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf12NP_524320.1 HFD_TAF12 90..162 CDD:467025 33/80 (41%)
taf12NP_594289.1 HFD_SF 1..450 CDD:480273 55/190 (29%)

Return to query results.
Submit another query.