DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf12 and taf-12

DIOPT Version :9

Sequence 1:NP_524320.1 Gene:Taf12 / 41406 FlyBaseID:FBgn0011290 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001255144.1 Gene:taf-12 / 176617 WormBaseID:WBGene00006396 Length:342 Species:Caenorhabditis elegans


Alignment Length:242 Identity:61/242 - (25%)
Similarity:91/242 - (37%) Gaps:80/242 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 HDPPMASPSQHSP--MTNNSNSSSQNGGPVS-GLGTGTGPISG------GSKSSNHTSSAAGSEN 88
            |...|..|.|..|  .|.|..|......|:. |:..|.|| ||      |.....|.....|...
 Worm   101 HFQQMGIPQQQQPQQFTPNGQSMQMQQRPMQMGMAQGPGP-SGHLMGMVGGPPPQHMMQQQGGGG 164

  Fly    89 TP-------------------------------------------------------------ML 92
            .|                                                             ::
 Worm   165 PPQFVPNSSPMPLPPQQIMQVQHQQQHQQPPPSQQIQQPPIPQPQQQQAPPPQMIPAAVPYGSIM 229

  Fly    93 TKPRLTELVREVDTTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERK 157
            .|.:|.:|::::.:||.|:|:|:::|::..||||...:.......|:|:..|||.||::...:..
 Worm   230 EKSKLDDLMQQISSTTVLEENVKDVLVEYADDFVSSLIDKACKMIKNREVKKIESRDIEFILKNV 294

  Fly   158 YNM-WIP-----GFG--TDELRPYKRAAV-TEAHKQRLALIRKTIKK 195
            ||| .:|     .||  |:.:...|...| |||||||:||::|.|||
 Worm   295 YNMPVVPRAASHNFGSQTEVIDLSKEKFVPTEAHKQRVALLKKQIKK 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf12NP_524320.1 TFIID_20kDa 93..159 CDD:112650 20/65 (31%)
taf-12NP_001255144.1 TFIID_20kDa 231..297 CDD:367691 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167996
Domainoid 1 1.000 54 1.000 Domainoid score I7577
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1569957at2759
OrthoFinder 1 1.000 - - FOG0004324
OrthoInspector 1 1.000 - - oto20623
orthoMCL 1 0.900 - - OOG6_103171
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1470
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.