DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18476 and PRDM16

DIOPT Version :9

Sequence 1:NP_731615.1 Gene:CG18476 / 41404 FlyBaseID:FBgn0037931 Length:936 Species:Drosophila melanogaster
Sequence 2:NP_071397.3 Gene:PRDM16 / 63976 HGNCID:14000 Length:1276 Species:Homo sapiens


Alignment Length:1139 Identity:196/1139 - (17%)
Similarity:316/1139 - (27%) Gaps:478/1139 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GAYCYVKQAMAANELL----------MKHLKNGAAPTSTDCLQEAPMELCAEQHVEVKLETE--- 118
            |...:.|:.|.|.|.|          .|....|.....|| ::.:|.|.|..: :...|.:|   
Human    95 GLGVWAKRKMEAGERLGPCVVVPRAAAKETDFGWEQILTD-VEVSPQEGCITK-ISEDLGSEKFC 157

  Fly   119 -DED--------------CGENDVTITCSELPEPDETDMESKKSVDP-LTMIETVKLEMEPRSVE 167
             |.:              |..:|..:|..::.|  :...:..|.::| ..::..||..:.|....
Human   158 VDANQAGAGSWLKYIRVACSCDDQNLTMCQISE--QIYYKVIKDIEPGEELLVHVKEGVYPLGTV 220

  Fly   168 KPAYD-DPTSDFEDEDSLDNLPLYNRIQKWKTGRKSVYKCHDCPRSFKRFDFLKRHE-------- 223
            .|..| :||                            ::|.:|...|:....|:||:        
Human   221 PPGLDEEPT----------------------------FRCDECDELFQSKLDLRRHKKYTCGSVG 257

  Fly   224 -------MRVHKPE------TRLYDCSLCIRKFSRSEALEAHLKIHRNSKRSANISEHKKAKAVD 275
                   ....|||      .:.::|..|.|.|....:||.|:.||...:.              
Human   258 AALYEGLAEELKPEGLGGGSGQAHECKDCERMFPNKYSLEQHMVIHTEERE-------------- 308

  Fly   276 LNLCKPHGYKLIECMICQSQYNKIADLRRHLEEHPDIVSLCGRPNMEPHELAELFYPDSKDLSEE 340
                    ||   |..|...:|..::|.||...|                               
Human   309 --------YK---CDQCPKAFNWKSNLIRHQMSH------------------------------- 331

  Fly   341 QLINLIRKDLAAGIYQRFYSITNQSGYEMDLDSSETDSDLDGDHDDQHKRRKKSRKATYSCELCQ 405
                                                         |..||        :.||.|.
Human   332 ---------------------------------------------DSGKR--------FECENCV 343

  Fly   406 QKFPRKYQLYDHQRQSHSWSDAPHVCGRCDGRFVSLQLLRHHNESQCRNAQKRFLCHKCPLRFRW 470
            :.|.....|..|.|..|..:.| |.|..|...|.:...|:.|  ....:..|.|:|..|...:..
Human   344 KVFTDPSNLQRHIRSQHVGARA-HACPDCGKTFATSSGLKQH--KHIHSTVKPFICEVCHKSYTQ 405

  Fly   471 KHNLKTHFREHRITNQTFECSECKRVFDKKKSLTVHLLSVHAEESKLIPCQWCSRKFYRHDYLVK 535
            ..||..|.|.|.......:|.:|.::|....||..|.             ::|..|        .
Human   406 FSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHR-------------RFCEGK--------N 449

  Fly   536 HLKRHGLKEHDIPLAETLIAATSRPNGAKRITCRMCNLHFERIVDLRAH---------------- 584
            |....|:....:||..:.:...::|:.    :....:|.|......|.|                
Human   450 HYTPGGIFAPGLPLTPSPMMDKAKPSP----SLNHASLGFNEYFPSRPHPGSLPFSTAPPTFPAL 510

  Fly   585 ------------------IQLELKLSLSLHQSYDS-----------PHNYSITN----------- 609
                              :.....|...|:.:.|:           |...:::|           
Human   511 TPGFPGIFPPSLYPRPPLLPPTSLLKSPLNHTQDAKLPSPLGNPALPLVSAVSNSSQGTTAAAGP 575

  Fly   610 ESGFELQLED----------------SETED---------EMQPGVGS----------------- 632
            |..||.:|||                |:.||         :...|.||                 
Human   576 EEKFESRLEDSCVEKLKTRSSDMSDGSDFEDVNTTTGTDLDTTTGTGSDLDSDVDSDPDKDKGKG 640

  Fly   633 -----RPVYICELCSVQCKRKFEMIQHQRTMHRFDKMPHE--------CDDCIFKCVSKSIMDHH 684
                 :|.:...|...........:....:.|.|...|.|        ..|.| |.::.....:.
Human   641 KSAEGQPKFGGGLAPPGAPNSVAEVPVFYSQHSFFPPPDEQLLTATGAAGDSI-KAIASIAEKYF 704

  Fly   685 RQGQCSSTEKK------HACGKCSYKFMWPENLEQHI------LLQHSKSSVSNPTGDRHTQGTG 737
            ..|.....|||      |:    ::.|.:..|....:      .|.|:....:.|...|      
Human   705 GPGFMGMQEKKLGSLPYHS----AFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPR------ 759

  Fly   738 DLEKDATEDGIPLLQCPH-----------------------------CDRTYQMKSRLNNH---- 769
                ||.:.|.|..:||.                             .|.:...::|.:.:    
Human   760 ----DALKVGGPSAECPFDLTTKPKDVKPILPMPKGPSAPASGEEQPLDLSIGSRARASQNGGGR 820

  Fly   770 -IRDVHINGDR----------------------------------------KRK----------- 782
             .|..|:.|:|                                        |||           
Human   821 EPRKNHVYGERKLGAGEGLPQVCPARMPQQPPLHYAKPSPFFMDPIYSRVEKRKVTDPVGALKEK 885

  Fly   783 ----------------EAIKRFLCSLCGMETRSAAAL--VTHMRRHTGEKPFKCDLCEMAFPRHS 829
                            |.:...|.|...|:..|.::|  :.|       .||.       |....
Human   886 YLRPSPLLFHPQMSAIETMTEKLESFAAMKADSGSSLQPLPH-------HPFN-------FRSPP 936

  Fly   830 ELASHRRMHTGEKPFHCTVCGKDFARSDKLKRHMLTHSGLKPHKCTYCEKSYRQAKDLKLHLQQ- 893
            ...|...:..|::.:.|..|||.|.||..|.||:.||:|.:|::|.||::|:..:.:|:.|::. 
Human   937 PTLSDPILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNI 1001

  Fly   894 HTGECPFVCGTCGERFIQSSTLEKHRLMRRHFDE 927
            |..|.||.|..|...|.|.:.|::|  :::|..|
Human  1002 HNKEKPFKCHLCNRCFGQQTNLDRH--LKKHEHE 1033

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18476NP_731615.1 zf-AD 6..84 CDD:285071 6/26 (23%)
C2H2 Zn finger 206..227 CDD:275368 6/35 (17%)
C2H2 Zn finger 236..256 CDD:275368 7/19 (37%)
C2H2 Zn finger 401..422 CDD:275368 7/20 (35%)
C2H2 Zn finger 431..447 CDD:275368 4/15 (27%)
C2H2 Zn finger 461..481 CDD:275368 6/19 (32%)
C2H2 Zn finger 490..511 CDD:275368 6/20 (30%)
C2H2 Zn finger 520..540 CDD:275368 3/19 (16%)
C2H2 Zn finger 638..659 CDD:275368 1/20 (5%)
C2H2 Zn finger 668..690 CDD:275368 4/21 (19%)
C2H2 Zn finger 698..715 CDD:275368 2/16 (13%)
C2H2 Zn finger 753..774 CDD:275368 5/54 (9%)
C2H2 Zn finger 790..810 CDD:275368 5/21 (24%)
zf-H2C2_2 802..825 CDD:290200 4/24 (17%)
COG5048 814..>886 CDD:227381 23/71 (32%)
C2H2 Zn finger 818..838 CDD:275368 2/19 (11%)
zf-H2C2_2 830..855 CDD:290200 7/24 (29%)
C2H2 Zn finger 846..866 CDD:275368 10/19 (53%)
zf-H2C2_2 859..883 CDD:290200 11/23 (48%)
C2H2 Zn finger 874..894 CDD:275368 6/20 (30%)
C2H2 Zn finger 902..924 CDD:275368 6/21 (29%)
PRDM16NP_071397.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..68
SET 84..209 CDD:214614 22/117 (19%)
C2H2 Zn finger 283..303 CDD:275368 7/19 (37%)
zf-H2C2_2 295..319 CDD:290200 9/48 (19%)
C2H2 Zn finger 311..331 CDD:275368 6/19 (32%)
zf-C2H2 337..358 CDD:278523 6/20 (30%)
C2H2 Zn finger 339..357 CDD:275368 6/17 (35%)
zf-C2H2 366..388 CDD:278523 6/23 (26%)
C2H2 Zn finger 368..388 CDD:275368 5/21 (24%)
zf-C2H2_8 369..450 CDD:292531 21/103 (20%)
zf-C2H2 394..416 CDD:278523 7/21 (33%)
C2H2 Zn finger 396..416 CDD:275368 6/19 (32%)
C2H2 Zn finger 425..443 CDD:275368 6/30 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 533..657 19/123 (15%)
Interaction with CTBP1, CTBP2 and ZNF516. /evidence=ECO:0000250|UniProtKB:A2A935 679..1038 74/386 (19%)
Mediates interaction with SKI and regulation of TGF-beta signaling. /evidence=ECO:0000269|PubMed:19049980 739..1276 63/321 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 772..804 1/31 (3%)
COG5048 931..>1083 CDD:227381 35/112 (31%)
zf-C2H2 951..973 CDD:278523 10/21 (48%)
C2H2 Zn finger 953..973 CDD:275368 10/19 (53%)
zf-H2C2_2 965..989 CDD:290200 11/23 (48%)
zf-C2H2 979..1002 CDD:278523 6/22 (27%)
C2H2 Zn finger 981..1002 CDD:275368 6/20 (30%)
zf-C2H2 1008..1030 CDD:278523 7/23 (30%)
C2H2 Zn finger 1010..1030 CDD:275368 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1033..1065 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1105..1163
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.